KEGG   Oryctolagus cuniculus (rabbit): 100341695
Entry
100341695         CDS       T03373                                 

Gene name
MAPK14
Definition
(RefSeq) mitogen-activated protein kinase 14
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01522  Endocrine resistance
ocu04010  MAPK signaling pathway
ocu04015  Rap1 signaling pathway
ocu04068  FoxO signaling pathway
ocu04071  Sphingolipid signaling pathway
ocu04114  Oocyte meiosis
ocu04218  Cellular senescence
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04370  VEGF signaling pathway
ocu04380  Osteoclast differentiation
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04611  Platelet activation
ocu04613  Neutrophil extracellular trap formation
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04657  IL-17 signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu04664  Fc epsilon RI signaling pathway
ocu04668  TNF signaling pathway
ocu04670  Leukocyte transendothelial migration
ocu04714  Thermogenesis
ocu04722  Neurotrophin signaling pathway
ocu04723  Retrograde endocannabinoid signaling
ocu04728  Dopaminergic synapse
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04912  GnRH signaling pathway
ocu04914  Progesterone-mediated oocyte maturation
ocu04917  Prolactin signaling pathway
ocu04926  Relaxin signaling pathway
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu04935  Growth hormone synthesis, secretion and action
ocu05014  Amyotrophic lateral sclerosis
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05132  Salmonella infection
ocu05133  Pertussis
ocu05135  Yersinia infection
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05161  Hepatitis B
ocu05163  Human cytomegalovirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05205  Proteoglycans in cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100341695 (MAPK14)
   04015 Rap1 signaling pathway
    100341695 (MAPK14)
   04370 VEGF signaling pathway
    100341695 (MAPK14)
   04668 TNF signaling pathway
    100341695 (MAPK14)
   04068 FoxO signaling pathway
    100341695 (MAPK14)
   04071 Sphingolipid signaling pathway
    100341695 (MAPK14)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100341695 (MAPK14)
   04218 Cellular senescence
    100341695 (MAPK14)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100341695 (MAPK14)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100341695 (MAPK14)
   04613  Neutrophil extracellular trap formation
    100341695 (MAPK14)
   04620 Toll-like receptor signaling pathway
    100341695 (MAPK14)
   04621 NOD-like receptor signaling pathway
    100341695 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    100341695 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    100341695 (MAPK14)
   04660 T cell receptor signaling pathway
    100341695 (MAPK14)
   04658 Th1 and Th2 cell differentiation
    100341695 (MAPK14)
   04659 Th17 cell differentiation
    100341695 (MAPK14)
   04657 IL-17 signaling pathway
    100341695 (MAPK14)
   04664 Fc epsilon RI signaling pathway
    100341695 (MAPK14)
   04670 Leukocyte transendothelial migration
    100341695 (MAPK14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100341695 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    100341695 (MAPK14)
   04917 Prolactin signaling pathway
    100341695 (MAPK14)
   04926 Relaxin signaling pathway
    100341695 (MAPK14)
   04935 Growth hormone synthesis, secretion and action
    100341695 (MAPK14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100341695 (MAPK14)
  09156 Nervous system
   04728 Dopaminergic synapse
    100341695 (MAPK14)
   04723 Retrograde endocannabinoid signaling
    100341695 (MAPK14)
   04722 Neurotrophin signaling pathway
    100341695 (MAPK14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100341695 (MAPK14)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100341695 (MAPK14)
  09159 Environmental adaptation
   04714 Thermogenesis
    100341695 (MAPK14)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100341695 (MAPK14)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100341695 (MAPK14)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100341695 (MAPK14)
   05020 Prion disease
    100341695 (MAPK14)
   05022 Pathways of neurodegeneration - multiple diseases
    100341695 (MAPK14)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100341695 (MAPK14)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100341695 (MAPK14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100341695 (MAPK14)
   05135 Yersinia infection
    100341695 (MAPK14)
   05133 Pertussis
    100341695 (MAPK14)
   05152 Tuberculosis
    100341695 (MAPK14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100341695 (MAPK14)
   05161 Hepatitis B
    100341695 (MAPK14)
   05171 Coronavirus disease - COVID-19
    100341695 (MAPK14)
   05163 Human cytomegalovirus infection
    100341695 (MAPK14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100341695 (MAPK14)
   05169 Epstein-Barr virus infection
    100341695 (MAPK14)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100341695 (MAPK14)
   05140 Leishmaniasis
    100341695 (MAPK14)
   05142 Chagas disease
    100341695 (MAPK14)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100341695 (MAPK14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100341695 (MAPK14)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100341695 (MAPK14)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100341695 (MAPK14)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH Kinase-like NAD_binding_8
Other DBs
NCBI-GeneID: 100341695
NCBI-ProteinID: XP_002714691
Ensembl: ENSOCUG00000029416
UniProt: A0A5F9DKW1
LinkDB
Position
12
AA seq 360 aa
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHDYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtctcaggagaggcccacgttctatcggcaggagctgaacaagacaatctgggaggtg
cccgagcgttaccagaatctgtccccggtgggctctggcgcctatggctccgtgtgtgct
gcttttgacacaaaaactgggttgcgcgttgctgtgaagaagctgtccaggccttttcag
tccatcattcatgccaaaaggacctacagggagctgcggctactcaaacatatgaaacat
gaaaatgtgattggtctattggacgtctttacacctgcaaggtctctggaggagttcaat
gacgtgtatctggtgacgcatctcatgggggcagatctgaacaacattgtgaaatgccaa
aagcttacagatgaccacgttcagttccttatctaccaaatcctccgaggcctaaagtat
atacattcagcggacataattcacagggacctaaagcctagtaacctagctgtgaacgaa
gactgtgagctgaagatcctggattttgggttggcgcgacacactgatgatgaaatgacg
ggctacgtggccaccaggtggtatcgggctcctgagatcatgctgaactggatgcattac
aaccagacagttgatatttggtcggtcggatgcataatggcggagctgttgactggaaga
acactgtttcctggtacagaccatattgatcagttgaagctcattttaagactcgttgga
accccaggggctgagcttttgaagaaaatctcctcagagtctgcaagaaactatattcag
tctttgacccagatgccgaagatgaactttgcaaatgtatttattggtgccaaccccttg
gccgttgacctgctggagaagatgcttgttttggactcagataagagaatcacagcagcc
caagccctcgcgcacgactactttgcccagtaccacgatccggacgacgagccggtggcc
gacccttacgatcagtcttttgaaagcagggacctgctcatagacgagtggaaaagcctg
acctatgatgaagtcatcagcttcgtgccgccacccctcgaccaagaagagatggagtcc
tga

KEGG   Oryctolagus cuniculus (rabbit): 100344161
Entry
100344161         CDS       T03373                                 

Gene name
MAPK13
Definition
(RefSeq) mitogen-activated protein kinase 13
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01522  Endocrine resistance
ocu04010  MAPK signaling pathway
ocu04015  Rap1 signaling pathway
ocu04068  FoxO signaling pathway
ocu04071  Sphingolipid signaling pathway
ocu04114  Oocyte meiosis
ocu04218  Cellular senescence
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04370  VEGF signaling pathway
ocu04380  Osteoclast differentiation
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04611  Platelet activation
ocu04613  Neutrophil extracellular trap formation
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04657  IL-17 signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu04664  Fc epsilon RI signaling pathway
ocu04668  TNF signaling pathway
ocu04670  Leukocyte transendothelial migration
ocu04714  Thermogenesis
ocu04722  Neurotrophin signaling pathway
ocu04723  Retrograde endocannabinoid signaling
ocu04728  Dopaminergic synapse
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04912  GnRH signaling pathway
ocu04914  Progesterone-mediated oocyte maturation
ocu04917  Prolactin signaling pathway
ocu04926  Relaxin signaling pathway
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu04935  Growth hormone synthesis, secretion and action
ocu05014  Amyotrophic lateral sclerosis
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05132  Salmonella infection
ocu05133  Pertussis
ocu05135  Yersinia infection
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05161  Hepatitis B
ocu05163  Human cytomegalovirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05205  Proteoglycans in cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100344161 (MAPK13)
   04015 Rap1 signaling pathway
    100344161 (MAPK13)
   04370 VEGF signaling pathway
    100344161 (MAPK13)
   04668 TNF signaling pathway
    100344161 (MAPK13)
   04068 FoxO signaling pathway
    100344161 (MAPK13)
   04071 Sphingolipid signaling pathway
    100344161 (MAPK13)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100344161 (MAPK13)
   04218 Cellular senescence
    100344161 (MAPK13)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100344161 (MAPK13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100344161 (MAPK13)
   04613  Neutrophil extracellular trap formation
    100344161 (MAPK13)
   04620 Toll-like receptor signaling pathway
    100344161 (MAPK13)
   04621 NOD-like receptor signaling pathway
    100344161 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    100344161 (MAPK13)
   04625 C-type lectin receptor signaling pathway
    100344161 (MAPK13)
   04660 T cell receptor signaling pathway
    100344161 (MAPK13)
   04658 Th1 and Th2 cell differentiation
    100344161 (MAPK13)
   04659 Th17 cell differentiation
    100344161 (MAPK13)
   04657 IL-17 signaling pathway
    100344161 (MAPK13)
   04664 Fc epsilon RI signaling pathway
    100344161 (MAPK13)
   04670 Leukocyte transendothelial migration
    100344161 (MAPK13)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100344161 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    100344161 (MAPK13)
   04917 Prolactin signaling pathway
    100344161 (MAPK13)
   04926 Relaxin signaling pathway
    100344161 (MAPK13)
   04935 Growth hormone synthesis, secretion and action
    100344161 (MAPK13)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100344161 (MAPK13)
  09156 Nervous system
   04728 Dopaminergic synapse
    100344161 (MAPK13)
   04723 Retrograde endocannabinoid signaling
    100344161 (MAPK13)
   04722 Neurotrophin signaling pathway
    100344161 (MAPK13)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100344161 (MAPK13)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100344161 (MAPK13)
  09159 Environmental adaptation
   04714 Thermogenesis
    100344161 (MAPK13)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100344161 (MAPK13)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100344161 (MAPK13)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100344161 (MAPK13)
   05020 Prion disease
    100344161 (MAPK13)
   05022 Pathways of neurodegeneration - multiple diseases
    100344161 (MAPK13)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100344161 (MAPK13)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100344161 (MAPK13)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100344161 (MAPK13)
   05135 Yersinia infection
    100344161 (MAPK13)
   05133 Pertussis
    100344161 (MAPK13)
   05152 Tuberculosis
    100344161 (MAPK13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100344161 (MAPK13)
   05161 Hepatitis B
    100344161 (MAPK13)
   05171 Coronavirus disease - COVID-19
    100344161 (MAPK13)
   05163 Human cytomegalovirus infection
    100344161 (MAPK13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100344161 (MAPK13)
   05169 Epstein-Barr virus infection
    100344161 (MAPK13)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100344161 (MAPK13)
   05140 Leishmaniasis
    100344161 (MAPK13)
   05142 Chagas disease
    100344161 (MAPK13)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100344161 (MAPK13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100344161 (MAPK13)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100344161 (MAPK13)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100344161 (MAPK13)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kinase-like Kdo
Other DBs
NCBI-GeneID: 100344161
NCBI-ProteinID: XP_002714701
Ensembl: ENSOCUG00000014799
LinkDB
Position
12
AA seq 366 aa
MSLTRRRGFYKQDVNKTAWELPKTYVSPTHVGSGAYGAVCSAIDKRSGEKVAIKKLSRPF
QSEIFARRAYRELLLLKHMQHENVIGLLDVFTPASSLRSFHDFYLVMPFMQTDLQKIMGM
EFSEDKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPGAEFVQKLKDKAAKTYIQSLPQMPKKDFTQLFPRASPQAVDLLEKMLELDVDKRLTAS
QALAHPFFEPFRDPEEETEAQQPFDDALEHEKLTVDEWKQHIYKEIMGFSPVTRKDSRRR
SGMKLQ
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgagcctcacccggagaaggggcttctacaagcaggacgtcaacaagaccgcctgggag
ctgcccaagacctacgtgtccccgacgcacgtcggcagcggggcctacggcgccgtgtgc
tccgccatcgacaagcggtctggggagaaggtggccatcaagaagcttagccggcccttc
cagtcggagatcttcgccaggcgggcctaccgcgagctgctgctgctcaaacacatgcag
catgagaacgtcattgggctcctggatgtctttaccccagcctcctccctgcgcagcttc
catgacttctacctggtgatgcccttcatgcagacggatctacagaagatcatgggcatg
gagttcagtgaggacaagatccagtacctggtttaccagatgcttaaaggtcttaagtac
atccactctgctggggtggtccacagggacctgaagccaggaaacctggccgtcaacgag
gactgtgaactgaagatcctggattttgggctggcgcggcacgcggacgccgagatgacg
ggctacgtggtgacgcgctggtaccgagcacccgaggtcatcctcagctggatgcactac
aaccagaccgtggacatctggtcggtgggctgcatcatggcggagatgctgaccgggaag
acgctgttcaagggcaaggactacctagaccagctgacccagatcctgaaagtgaccgga
gtgcccggggccgagtttgtgcagaagctgaaggacaaagcagccaaaacctacatccag
tccctgccccagatgcccaagaaggacttcactcagctcttcccacgggccagcccccag
gccgtagacctgctggagaagatgctggaactggacgtggacaagcgcctgacggcctcg
caggccctcgcccaccccttctttgaacccttccgggaccccgaggaagagacggaggcc
cagcagccgttcgatgacgccttggaacacgagaagctcacagtggatgaatggaagcag
cacatctacaaggagattatgggcttcagccccgtgacgcggaaggactcacggcgccgg
agtggcatgaagctgcagtga

KEGG   Oryctolagus cuniculus (rabbit): 100350614
Entry
100350614         CDS       T03373                                 

Gene name
MAPK12
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01522  Endocrine resistance
ocu04010  MAPK signaling pathway
ocu04015  Rap1 signaling pathway
ocu04068  FoxO signaling pathway
ocu04071  Sphingolipid signaling pathway
ocu04114  Oocyte meiosis
ocu04218  Cellular senescence
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04370  VEGF signaling pathway
ocu04380  Osteoclast differentiation
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04611  Platelet activation
ocu04613  Neutrophil extracellular trap formation
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04657  IL-17 signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu04664  Fc epsilon RI signaling pathway
ocu04668  TNF signaling pathway
ocu04670  Leukocyte transendothelial migration
ocu04714  Thermogenesis
ocu04722  Neurotrophin signaling pathway
ocu04723  Retrograde endocannabinoid signaling
ocu04728  Dopaminergic synapse
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04912  GnRH signaling pathway
ocu04914  Progesterone-mediated oocyte maturation
ocu04917  Prolactin signaling pathway
ocu04926  Relaxin signaling pathway
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu04935  Growth hormone synthesis, secretion and action
ocu05014  Amyotrophic lateral sclerosis
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05132  Salmonella infection
ocu05133  Pertussis
ocu05135  Yersinia infection
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05161  Hepatitis B
ocu05163  Human cytomegalovirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05205  Proteoglycans in cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100350614 (MAPK12)
   04015 Rap1 signaling pathway
    100350614 (MAPK12)
   04370 VEGF signaling pathway
    100350614 (MAPK12)
   04668 TNF signaling pathway
    100350614 (MAPK12)
   04068 FoxO signaling pathway
    100350614 (MAPK12)
   04071 Sphingolipid signaling pathway
    100350614 (MAPK12)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100350614 (MAPK12)
   04218 Cellular senescence
    100350614 (MAPK12)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100350614 (MAPK12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100350614 (MAPK12)
   04613  Neutrophil extracellular trap formation
    100350614 (MAPK12)
   04620 Toll-like receptor signaling pathway
    100350614 (MAPK12)
   04621 NOD-like receptor signaling pathway
    100350614 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    100350614 (MAPK12)
   04625 C-type lectin receptor signaling pathway
    100350614 (MAPK12)
   04660 T cell receptor signaling pathway
    100350614 (MAPK12)
   04658 Th1 and Th2 cell differentiation
    100350614 (MAPK12)
   04659 Th17 cell differentiation
    100350614 (MAPK12)
   04657 IL-17 signaling pathway
    100350614 (MAPK12)
   04664 Fc epsilon RI signaling pathway
    100350614 (MAPK12)
   04670 Leukocyte transendothelial migration
    100350614 (MAPK12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100350614 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    100350614 (MAPK12)
   04917 Prolactin signaling pathway
    100350614 (MAPK12)
   04926 Relaxin signaling pathway
    100350614 (MAPK12)
   04935 Growth hormone synthesis, secretion and action
    100350614 (MAPK12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100350614 (MAPK12)
  09156 Nervous system
   04728 Dopaminergic synapse
    100350614 (MAPK12)
   04723 Retrograde endocannabinoid signaling
    100350614 (MAPK12)
   04722 Neurotrophin signaling pathway
    100350614 (MAPK12)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100350614 (MAPK12)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100350614 (MAPK12)
  09159 Environmental adaptation
   04714 Thermogenesis
    100350614 (MAPK12)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100350614 (MAPK12)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100350614 (MAPK12)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100350614 (MAPK12)
   05020 Prion disease
    100350614 (MAPK12)
   05022 Pathways of neurodegeneration - multiple diseases
    100350614 (MAPK12)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100350614 (MAPK12)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100350614 (MAPK12)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100350614 (MAPK12)
   05135 Yersinia infection
    100350614 (MAPK12)
   05133 Pertussis
    100350614 (MAPK12)
   05152 Tuberculosis
    100350614 (MAPK12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100350614 (MAPK12)
   05161 Hepatitis B
    100350614 (MAPK12)
   05171 Coronavirus disease - COVID-19
    100350614 (MAPK12)
   05163 Human cytomegalovirus infection
    100350614 (MAPK12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100350614 (MAPK12)
   05169 Epstein-Barr virus infection
    100350614 (MAPK12)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100350614 (MAPK12)
   05140 Leishmaniasis
    100350614 (MAPK12)
   05142 Chagas disease
    100350614 (MAPK12)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100350614 (MAPK12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100350614 (MAPK12)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100350614 (MAPK12)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100350614 (MAPK12)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like UvrD_C
Other DBs
NCBI-GeneID: 100350614
NCBI-ProteinID: XP_008249684
Ensembl: ENSOCUG00000007543
LinkDB
Position
Un
AA seq 367 aa
MSSPPPAPQGFTGQEVTKTAWEVRAVYHDLQPVGSGAYGAVCSAVDSRTGAKVAIKKLYR
PFQSELFAKRAYRELRLLQHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLM
KHEKLSEDRIQFLVYQMLKGLKYIHAAGVIHRDLKPGNLAVNEDCELKILDFGLARQADS
EMTGYVVTRWYRAPEVILNWMHYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMK
VTGTPPADFVQKLRSADAKQYMQGLPECERKDFASVVTNASPLAVNLLEKMLVLDGDQRV
TAAEALAHPYFESLHDTEDEPTAQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGAR
VSKETAL
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgagctcgccgccaccggccccgcaagggtttaccggccaggaggtgaccaagaccgcc
tgggaggtgcgcgctgtgtatcatgacctgcagcccgtgggctccggcgcctacggcgcc
gtgtgctcggcagtggacagccgcacgggcgccaaggtggccatcaagaagctgtaccgt
cccttccagtcggagctgttcgccaagcgtgcctaccgcgagctgcgcctgctccagcac
atgcgccacgagaacgtgatcggcctgctggacgtgttcactccagacgagaccctggac
gacttcacagacttttacctggtgatgccgttcatgggcaccgacctgggcaagctcatg
aagcacgagaagctgagtgaggaccgcatccagttcctggtgtaccagatgctgaagggg
ctgaagtacatccacgctgctggcgtcatccacagggacttgaagcccggcaacctggca
gtgaatgaggactgtgagctgaagatcctggactttggcctggccaggcaggctgacagt
gagatgactggctatgtggtgacccggtggtaccgggcccccgaggtcatcctgaactgg
atgcactacacacagacagtggacatctggtcggtgggctgcatcatggcggagatgatt
acggggaagacgctgttcaagggcagtgaccacctggaccagctgaaggagatcatgaag
gtgacagggacgcctccggccgacttcgtgcaaaagctgcggagcgctgatgccaagcag
tacatgcagggcctccccgagtgtgagaggaaggactttgcctccgtggtgaccaacgca
agccctctggccgtgaacctcctggagaagatgttggtgctggacggggaccagcgggtg
acagcggccgaggcgctggcccacccctacttcgagtccctgcacgacacggaggacgag
cccacagcccagaagtacgacgactcctttgatgacgtggaccgcaccctggacgagtgg
aagcgtgtcacttacaaagaggtgctcagcttcaagcctcccaggcagctgggggccagg
gtctccaaggagacggccctgtga

KEGG   Oryctolagus cuniculus (rabbit): 103346035
Entry
103346035         CDS       T03373                                 

Gene name
MAPK11
Definition
(RefSeq) mitogen-activated protein kinase 11
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01522  Endocrine resistance
ocu04010  MAPK signaling pathway
ocu04015  Rap1 signaling pathway
ocu04068  FoxO signaling pathway
ocu04071  Sphingolipid signaling pathway
ocu04114  Oocyte meiosis
ocu04218  Cellular senescence
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04370  VEGF signaling pathway
ocu04380  Osteoclast differentiation
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04611  Platelet activation
ocu04613  Neutrophil extracellular trap formation
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04657  IL-17 signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu04664  Fc epsilon RI signaling pathway
ocu04668  TNF signaling pathway
ocu04670  Leukocyte transendothelial migration
ocu04714  Thermogenesis
ocu04722  Neurotrophin signaling pathway
ocu04723  Retrograde endocannabinoid signaling
ocu04728  Dopaminergic synapse
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04912  GnRH signaling pathway
ocu04914  Progesterone-mediated oocyte maturation
ocu04917  Prolactin signaling pathway
ocu04926  Relaxin signaling pathway
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu04935  Growth hormone synthesis, secretion and action
ocu05014  Amyotrophic lateral sclerosis
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05132  Salmonella infection
ocu05133  Pertussis
ocu05135  Yersinia infection
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05161  Hepatitis B
ocu05163  Human cytomegalovirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05205  Proteoglycans in cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103346035 (MAPK11)
   04015 Rap1 signaling pathway
    103346035 (MAPK11)
   04370 VEGF signaling pathway
    103346035 (MAPK11)
   04668 TNF signaling pathway
    103346035 (MAPK11)
   04068 FoxO signaling pathway
    103346035 (MAPK11)
   04071 Sphingolipid signaling pathway
    103346035 (MAPK11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103346035 (MAPK11)
   04218 Cellular senescence
    103346035 (MAPK11)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103346035 (MAPK11)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103346035 (MAPK11)
   04613  Neutrophil extracellular trap formation
    103346035 (MAPK11)
   04620 Toll-like receptor signaling pathway
    103346035 (MAPK11)
   04621 NOD-like receptor signaling pathway
    103346035 (MAPK11)
   04622 RIG-I-like receptor signaling pathway
    103346035 (MAPK11)
   04625 C-type lectin receptor signaling pathway
    103346035 (MAPK11)
   04660 T cell receptor signaling pathway
    103346035 (MAPK11)
   04658 Th1 and Th2 cell differentiation
    103346035 (MAPK11)
   04659 Th17 cell differentiation
    103346035 (MAPK11)
   04657 IL-17 signaling pathway
    103346035 (MAPK11)
   04664 Fc epsilon RI signaling pathway
    103346035 (MAPK11)
   04670 Leukocyte transendothelial migration
    103346035 (MAPK11)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103346035 (MAPK11)
   04914 Progesterone-mediated oocyte maturation
    103346035 (MAPK11)
   04917 Prolactin signaling pathway
    103346035 (MAPK11)
   04926 Relaxin signaling pathway
    103346035 (MAPK11)
   04935 Growth hormone synthesis, secretion and action
    103346035 (MAPK11)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103346035 (MAPK11)
  09156 Nervous system
   04728 Dopaminergic synapse
    103346035 (MAPK11)
   04723 Retrograde endocannabinoid signaling
    103346035 (MAPK11)
   04722 Neurotrophin signaling pathway
    103346035 (MAPK11)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103346035 (MAPK11)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103346035 (MAPK11)
  09159 Environmental adaptation
   04714 Thermogenesis
    103346035 (MAPK11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103346035 (MAPK11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103346035 (MAPK11)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    103346035 (MAPK11)
   05020 Prion disease
    103346035 (MAPK11)
   05022 Pathways of neurodegeneration - multiple diseases
    103346035 (MAPK11)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103346035 (MAPK11)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103346035 (MAPK11)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103346035 (MAPK11)
   05135 Yersinia infection
    103346035 (MAPK11)
   05133 Pertussis
    103346035 (MAPK11)
   05152 Tuberculosis
    103346035 (MAPK11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103346035 (MAPK11)
   05161 Hepatitis B
    103346035 (MAPK11)
   05171 Coronavirus disease - COVID-19
    103346035 (MAPK11)
   05163 Human cytomegalovirus infection
    103346035 (MAPK11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103346035 (MAPK11)
   05169 Epstein-Barr virus infection
    103346035 (MAPK11)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103346035 (MAPK11)
   05140 Leishmaniasis
    103346035 (MAPK11)
   05142 Chagas disease
    103346035 (MAPK11)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103346035 (MAPK11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    103346035 (MAPK11)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103346035 (MAPK11)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103346035 (MAPK11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Cas_CT1975 Kinase-like
Other DBs
NCBI-GeneID: 103346035
NCBI-ProteinID: XP_017194750
LinkDB
Position
Un
AA seq 364 aa
MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQ
SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQ
ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVG
TPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAA
EALAHAYFSQYHDPDDEPVAEPYDESVEAKERTVEEWKELTYQEVLSFKPPESPQPSGSL
DIEQ
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgtcggggccccgcgccggcttctaccggcaggagctgaacaagacggtgtgggaggtg
ccgcagaggctgcaggggctgcgcccggtgggctccggcgcctacggctcggtctgctca
gcctacgacgcccggctgcggcagaaggtggcggtgaagaagctctcgcggcccttccag
tcgctgatccacgcccgcaggacgtaccgggagctgcggctgctcaagcacctcaagcat
gagaacgtcatcgggcttctggacgtcttcacgccagccacgtccatcgaggacttcagt
gaagtgtacttggtgaccaccctgatgggcgcagacctgaacaacatcgtcaagtgccag
gcgctgagtgacgaacacgtccagttcctggtataccagctgctgcgtgggctgaagtac
atccactctgcagggatcatccaccgggacctgaaacccagcaacgtggcggtgaatgaa
gactgcgagctcaggatcctagacttcggactggcccgccaggctgacgaggagatgacc
ggctacgtggccacacgctggtaccgagccccagagatcatgctgaactggatgcactac
aaccagacagtggatatctggtccgtgggctgtatcatggccgagctgctgcaggggaag
gctctcttcccgggaagtgactacatcgaccagctgaagcggatcatggaggtggtgggt
acgcccagccctgaggttctggccaagatttcctcggagcatgcccggacctacatccag
tctctgccccccatgcctcagaaggacctcagcagcatcttccgcggagccaaccccctg
gctatagatctcctcgggaggatgctggtgctggacagcgaccagcgggtcagcgccgcg
gaggccctggcccacgcctacttcagccagtaccacgaccccgacgatgagccggtggcc
gagccctatgacgaaagcgttgaggccaaggagcgcacagtggaggagtggaaggagctc
acctaccaggaggttctcagcttcaagcccccggagtcaccacagccatctggtagcctg
gacattgagcagtga

DBGET integrated database retrieval system