KEGG   Oryctolagus cuniculus (rabbit): 100341830
Entry
100341830         CDS       T03373                                 

Gene name
NLRX1
Definition
(RefSeq) NLR family member X1
  KO
K12653  NLR family member X1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100341830 (NLRX1)
   04622 RIG-I-like receptor signaling pathway
    100341830 (NLRX1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100341830 (NLRX1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:ocu04054]
    100341830 (NLRX1)
Pattern recognition receptors [BR:ocu04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   100341830 (NLRX1)
SSDB
Motif
Pfam: NACHT LRR_6 AAA_22 DUF815 AAA_16 TsaE AAA_25 NLRC4_HD2
Other DBs
NCBI-GeneID: 100341830
NCBI-ProteinID: XP_017194144
LinkDB
Position
Un
AA seq 867 aa
MRWGRHLPRAYWGSGLGRSPPPPGDCTSSLVRRSWPLKGEHPLAPPRAFARHRGSSADSA
PPPGRHGQLFRSVSAAEAIQRHRRNLAEWFSRLPREERQFGPTFALDTVHVDPVIRESTP
DELLRPPAELAVEQQPLLPGPPPLALSQLFEPDACGRRVQTVVLYGTVGTGKSTLVRKMV
LDWCYGRLPAFELLIPFSCEDLSSLGPAPASLCQLVAQRYAPLKEILPLMAAAGSRLLFV
LHGLERLNLDFRLAGTGLCSDPQEPGAPAAVIVNLLRKYMLPEASILVTTRPSAVGRIPS
KYVGRYGKICGFSDTNLEKLYFQLRLNQPDCGHGAGGAGVSTTPAQRDNLVQMLSRNLEG
HHQIAAACFLPSYCWLVCATLHFLHAPTPPGQTLTSINTSFLRLNFSEPALAWELVLRRQ
NPGLCGQNSKFPFSIGTKAAGSPVLLPLQVAPRVFGRVVGKSREAVAQAMVLEMFREEDY
HNDDVLDQMGASILGVEGPRRHPDEPPEDEVFELFPMFMGGLLSAHNRLVLAQLGCPIKN
MDALENTQAIKKKLDKLGRQPLPPSELLDHLFFHYEFQNQRFSAEVLSSLRQLHLAGVRM
TPLKCTVVAAVLGSGRHALDEVNLASCQLDPAGLRTLRPVLLRARKLGLQLNSLGPDACR
DLRDLLLDEQCQISTLRLSNNPLTAAGVALLMEGLAGNTSLTHLSLLHTGLGDEGLELLA
AQLDRNQQLQELNVAYNGAGDTAALALAKAAREHPSLELLHLYFNELSSEGRQVLRDLGA
AAGGGARVVASLTEGTAVSEYWSVILSEVQRNLNSWDRARVRRHLELLLRDLEDSRGATL
NPWRKAQLLRVQGEVRALVEQLGAPGS
NT seq 2604 nt   +upstreamnt  +downstreamnt
atgagatggggccgccatttgcccagggcctactggggctctggtctgggaagatcacca
ccacccccaggcgattgtacctcctccctggtccgccggagctggccccttaaaggggag
cacccccttgcgccccctagggcctttgcacgccaccgtgggagctcagctgacagtgct
cccccaccagggaggcacggacagctgttcaggagcgtctcagcagctgaggccatccag
cggcaccgccggaacctggctgagtggttcagccggctgcccagggaggaacgtcagttt
gggccaacctttgcgctggacacagttcacgttgaccctgtgatccgtgagagcaccccc
gatgagctcctgcgtccacctgccgagctggccgtggagcagcagccgctgctaccgggg
cccccgccgctcgccctgtctcagctctttgagccagatgcctgcgggcgccgggtacag
actgtggtgctctatggcacggtgggcacaggcaagagcacgctggtgcgcaagatggtt
ctggattggtgttacgggcggctgccagccttcgagctgctcatccccttctcctgtgag
gacctgtcgtccctgggccctgccccagcctccttgtgccaactggtggcccagcgctac
gcgcccctgaaggagattctgcccctgatggctgcagccgggtctcgcctgctgtttgtg
ctccatggcctggagcggctcaacctcgacttccggctggcgggcacagggctttgtagt
gacccccaggagccgggggcaccggctgctgtcatcgtcaacctgctacgcaaatacatg
ctccccgaggcgagcatcctggtgaccacacggccctctgccgtcggccgcatccccagc
aagtacgtgggccgctacggaaagatctgcggcttctctgataccaacctggagaagctc
tacttccagctccgcctcaaccagccggactgtgggcacggcgcggggggagccggtgtc
tcaaccacgcccgctcagcgcgacaacctggtgcagatgctctcgcggaacctggagggg
caccaccagatcgccgccgcctgcttcctgccctcctattgctggctcgtctgtgccacc
ttacactttctgcatgcgcctacgcctcccgggcagaccctcaccagcatcaacaccagc
ttcttgcggctcaacttcagtgagcctgctcttgcctgggagctggtcctgaggaggcag
aaccctggtctgtgcgggcagaattccaagtttcccttttctataggcaccaaggctgca
gggtcccccgttctgctccctctgcaggtggccccgcgagtgttcggccgcgtggtgggg
aagagccgggaggcagtagcccaggccatggtgctggagatgtttcgggaggaggactac
cacaacgatgacgttctggaccagatgggcgccagcatcctgggcgtggagggcccccgg
cgccacccggacgagccccccgaggatgaagtctttgagctcttccccatgttcatgggg
gggctgctctctgcgcacaaccggctcgtgctggctcagctcggctgtcccatcaagaac
atggacgccctggagaacactcaggccatcaagaagaagctggacaagctgggccggcag
ccgctgcccccctcggagctccttgaccacctgttcttccactacgagttccagaaccag
cgcttctccgcggaggtgctcagctccctgcgccagctccacctggccggggtgcgcatg
acacccctcaagtgcacggtggtggcggctgtgctgggcagcgggaggcatgccctggac
gaggtgaacttggcctcctgccagctggaccctgccgggctgcgcacactcaggcccgtc
ttgctgcgtgcccggaagctgggcctgcaactcaacagcctgggccccgacgcctgcagg
gacctccgagacctgctgctggacgaacagtgccaaatcagcacgctgcggctgtccaac
aacccgctgacagctgcaggtgtcgccctgctcatggaggggctggcgggaaacacttcg
ctgacacacctgtccctgctgcacaccggccttggagatgagggcctggagctgctggct
gcccagctggatagaaaccagcagctgcaggagctgaacgtggcctacaatggcgctggc
gacaccgcggccctggccctggccaaggctgcccgggagcacccgtccctggagctgcta
cacctctacttcaacgagctgagctccgagggccgccaggtcctgcgggacctgggggct
gctgctggaggcggcgcccgggtggtggcttctctgacagaggggacggcagtgtctgag
tactggtccgtgatcctcagcgaagtccagcggaacctcaacagctgggatcgggcccgg
gtccggcgccacctcgagctgctgctgcgggatctagaagacagccgcggggccaccctc
aatccttggcgcaaggcccagctgctgcgggtgcagggcgaggtcagagcccttgtggag
cagctgggagcccccggaagctga

DBGET integrated database retrieval system