KEGG   Oryctolagus cuniculus (rabbit): 100342046
Entry
100342046         CDS       T03373                                 

Gene name
BAK1
Definition
(RefSeq) BCL2 antagonist/killer 1
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu04141  Protein processing in endoplasmic reticulum
ocu04210  Apoptosis
ocu04215  Apoptosis - multiple species
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05132  Salmonella infection
ocu05160  Hepatitis C
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05202  Transcriptional misregulation in cancer
ocu05203  Viral carcinogenesis
ocu05206  MicroRNAs in cancer
ocu05210  Colorectal cancer
ocu05212  Pancreatic cancer
ocu05213  Endometrial cancer
ocu05214  Glioma
ocu05216  Thyroid cancer
ocu05217  Basal cell carcinoma
ocu05218  Melanoma
ocu05220  Chronic myeloid leukemia
ocu05222  Small cell lung cancer
ocu05223  Non-small cell lung cancer
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100342046 (BAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100342046 (BAK1)
   04215 Apoptosis - multiple species
    100342046 (BAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100342046 (BAK1)
   05202 Transcriptional misregulation in cancer
    100342046 (BAK1)
   05206 MicroRNAs in cancer
    100342046 (BAK1)
   05203 Viral carcinogenesis
    100342046 (BAK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100342046 (BAK1)
   05212 Pancreatic cancer
    100342046 (BAK1)
   05225 Hepatocellular carcinoma
    100342046 (BAK1)
   05226 Gastric cancer
    100342046 (BAK1)
   05214 Glioma
    100342046 (BAK1)
   05216 Thyroid cancer
    100342046 (BAK1)
   05220 Chronic myeloid leukemia
    100342046 (BAK1)
   05217 Basal cell carcinoma
    100342046 (BAK1)
   05218 Melanoma
    100342046 (BAK1)
   05213 Endometrial cancer
    100342046 (BAK1)
   05224 Breast cancer
    100342046 (BAK1)
   05222 Small cell lung cancer
    100342046 (BAK1)
   05223 Non-small cell lung cancer
    100342046 (BAK1)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    100342046 (BAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100342046 (BAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100342046 (BAK1)
   05162 Measles
    100342046 (BAK1)
   05164 Influenza A
    100342046 (BAK1)
   05160 Hepatitis C
    100342046 (BAK1)
   05168 Herpes simplex virus 1 infection
    100342046 (BAK1)
   05163 Human cytomegalovirus infection
    100342046 (BAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100342046 (BAK1)
   05169 Epstein-Barr virus infection
    100342046 (BAK1)
   05165 Human papillomavirus infection
    100342046 (BAK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100342046 (BAK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ocu03029]
    100342046 (BAK1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ocu02000]
    100342046 (BAK1)
Mitochondrial biogenesis [BR:ocu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    100342046 (BAK1)
Transporters [BR:ocu02000]
 Other transporters
  Pores ion channels [TC:1]
   100342046 (BAK1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3 DUF5700
Other DBs
NCBI-GeneID: 100342046
NCBI-ProteinID: XP_008261011
Ensembl: ENSOCUG00000002556
UniProt: U3KMG3
LinkDB
Position
12
AA seq 210 aa
MASGQGPGPPGEGCGEPPEPSTSEQQVARDTEEVFRSYVFHRHRQEQEAEGAAAPADPEM
ISLHLEPNSTMGQVGRQLAIIGDDINQRYDSDFQNMLEKLQPTAENAYELFTKIALSLFE
SGINWGRVVALLAFGYRLALYIYRRGLTGFLGQVTRFVADFVVHHCIAQWIAQRGGWVAV
LSSHNPILTVLAALAVVAFCQFVVRRHFKS
NT seq 633 nt   +upstreamnt  +downstreamnt
atggcatccgggcaaggcccaggtcctcctggcgaaggctgtggagagcctcccgagccc
tccacttctgagcagcaggtagcccgggacacggaggaggttttccgcagctacgttttc
caccgccaccggcaggagcaggaggccgagggggcggctgcccctgctgacccggagatg
atctccttgcacctggaacctaacagcaccatggggcaggtggggcggcagctcgccatc
attggggacgacatcaaccagcgctatgactcagatttccagaacatgctagagaagctg
cagcccacggccgagaacgcctatgagctgttcaccaagatcgccttgagcctgtttgag
agtggcatcaactggggccgcgtggtggctctcctggccttcggctaccgcctggccctg
tacatctaccggcgcggcctgaccggcttcctgggccaggtgacccgcttcgtggccgac
tttgtggtgcatcactgcatcgcccagtggatcgcgcagaggggcggctgggtggcagtc
ctgagctcgcacaaccccatcctgacagtgctggcggccctggccgtggtcgcgttctgc
cagttcgtggtacgaagacacttcaagtcatga

DBGET integrated database retrieval system