KEGG   Oryctolagus cuniculus (rabbit): 100342294
Entry
100342294         CDS       T03373                                 

Gene name
SMAD4
Definition
(RefSeq) SMAD family member 4
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04068  FoxO signaling pathway
ocu04110  Cell cycle
ocu04310  Wnt signaling pathway
ocu04350  TGF-beta signaling pathway
ocu04371  Apelin signaling pathway
ocu04390  Hippo signaling pathway
ocu04520  Adherens junction
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04659  Th17 cell differentiation
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu05161  Hepatitis B
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
ocu05212  Pancreatic cancer
ocu05220  Chronic myeloid leukemia
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100342294 (SMAD4)
   04350 TGF-beta signaling pathway
    100342294 (SMAD4)
   04390 Hippo signaling pathway
    100342294 (SMAD4)
   04371 Apelin signaling pathway
    100342294 (SMAD4)
   04068 FoxO signaling pathway
    100342294 (SMAD4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100342294 (SMAD4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100342294 (SMAD4)
   04550 Signaling pathways regulating pluripotency of stem cells
    100342294 (SMAD4)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100342294 (SMAD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100342294 (SMAD4)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100342294 (SMAD4)
   05212 Pancreatic cancer
    100342294 (SMAD4)
   05225 Hepatocellular carcinoma
    100342294 (SMAD4)
   05226 Gastric cancer
    100342294 (SMAD4)
   05220 Chronic myeloid leukemia
    100342294 (SMAD4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100342294 (SMAD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100342294 (SMAD4)
   05161 Hepatitis B
    100342294 (SMAD4)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 100342294
NCBI-ProteinID: XP_002713587
Ensembl: ENSOCUG00000003929
UniProt: G1SKR1
LinkDB
Position
9
AA seq 552 aa
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPPSMLVKDEYVHDFEGQPSLSTEGHSIQ
TIQHPPSNRGSTETYSTPALLAPSESNAAGTTNFPNIPVASTSQPASILAGSHSEGLLQI
ASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGH
YWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGD
RFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR
APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAP
AISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVL
HTMPIADPQPLD
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggacaatatgtctattacgaatacaccaacaagtaatgatgcctgtctaagcattgta
catagtttgatgtgccatagacaaggtggagagagtgaaacatttgcaaaaagagcaatt
gaaagtttggtaaagaagctgaaggagaaaaaagatgaattagattctttaataacagct
ataactacaaatggagctcatcctagtaaatgtgttaccatacagagaacgttggatgga
cgactgcaggtggctggtcggaagggatttcctcatgtgatatatgcccgtctctggaga
tggcctgatcttcacaaaaatgaactaaaacatgttaaatattgtcagtatgcatttgac
ttaaaatgtgacagtgtctgtgtgaatccgtatcactatgaacgagttgtctcacctgga
attgatctctcaggattaacgctgcagagtaatgctccaccaagcatgttggtaaaggat
gaatatgttcatgactttgagggacagccatcattatccactgaaggacattcaattcaa
accatccagcatccaccaagtaatcgcggatcaaccgagacatacagcaccccagctctg
ttagccccatctgagtctaatgctgccggcaccaccaactttcccaacattcctgtggct
tccacaagtcagcctgccagtatactggcaggcagccatagtgaaggactgttgcagata
gcttcagggcctcagccaggacagcagcagaatggatttactggtcagccagctacttac
catcataacagcactactacctggactggaagtaggactgcaccatacacacctaatttg
cctcaccaccaaaacggccatcttcagcaccacccgcctatgccgccccatcccggacat
tactggccagttcacaatgagcttgcattccagcctcccatatccaatcatcctgctcct
gaatattggtgttccattgcttattttgaaatggatgttcaggtaggagagacatttaag
gttccttcaagctgccctattgttactgttgatggatacgtggacccttcaggaggagat
cgcttttgcttgggtcaactctccaatgtccacaggacagaagccattgagagagcaagg
ttacacataggcaaaggtgtgcagttggaatgtaaaggtgaaggtgacgtttgggtcagg
tgccttagcgaccatgcggtctttgtacagagttactacctagacagagaagctgggcgt
gcacctggagatgctgttcataagatctacccaagtgcatatataaaggtctttgattta
cgtcagtgtcatcgacagatgcagcagcaagcagccactgcacaagctgcagcagctgcc
caggcagcagctgtggcaggaaacatccctggcccaggatcagtaggtggaatagctcca
gctatcagtctgtcagctgctgctggaatcggtgttgatgaccttcgtcgtttatgcata
ctcaggatgagttttgtgaaaggctggggaccggattacccacgacaaagtatcaaagaa
acgccttgctggattgagattcacttgcacagggctctccagctcctggatgaagtactt
cacaccatgcccattgcagacccacagcccttagactga

DBGET integrated database retrieval system