KEGG   Oryctolagus cuniculus (rabbit): 100342333
Entry
100342333         CDS       T03373                                 

Gene name
CSTF2
Definition
(RefSeq) cleavage stimulation factor subunit 2
  KO
K14407  cleavage stimulation factor subunit 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100342333 (CSTF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100342333 (CSTF2)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage stimulation factor (CSTF) complex
     100342333 (CSTF2)
SSDB
Motif
Pfam: CSTF2_hinge RRM_1 CSTF_C RRM_7 RRM_occluded
Other DBs
NCBI-GeneID: 100342333
NCBI-ProteinID: XP_002720432
Ensembl: ENSOCUG00000010468
LinkDB
Position
X
AA seq 576 aa
MAGLTVRDPAVDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYG
FCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGTGAPVIESPYGETIS
PEDAPESISKAVASLPPEQMFELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMR
IVDPEIALKILHRQTNIPTLIAGNPQPVHGAGPGSGSSVSMNQPNPQGPQPQSLGGMHVN
GAPPLMQASMPGGVPAPGQMAAAVTGPGPGSLAPGGGMQTQVGMPGGGPVPMERGQVPMQ
DPRAALQRGSLPANVPTPRGLLGDAPNDPRGGTLLSVTGDVEPRGYLGPPHQGPPMHHVP
GHESRGPPPHEMRGGPLAEPRPLMAEPRGPMLDQRGPPLDGRGGRDPRGIDARSMEARAM
EARGLDARSMEARAMEARAMEARAMEARAMEVRAMEVRGMEARGMDTRGPVPGPRGPLPS
GMPGPAPMNMAVGPQGARQVPVMQGAGMQGASLQGGSQPGAFSPGQNQVTPQDHEKAALI
MQVLQLTADQIAMLPPEQRQSILILKEQIQKSTGAP
NT seq 1731 nt   +upstreamnt  +downstreamnt
atggcgggtttgactgttagagaccctgcggtggatcgttctctacgttctgtatttgtg
ggaaacattccttatgaagctactgaagaacaattaaaggacatcttttctgaggttgga
cctgttgttagttttagattggtatatgatagggaaacaggaaagccaaagggttatggc
ttctgtgaataccaagaccaagagacagcacttagtgccatgcggaacctgaatggacgt
gaattcagtgggagagcacttcgagtggacaatgcagccagtgaaaagaacaaagaagag
ttaaagagccttggcactggtgccccagtcattgagtcaccttatggagagaccatcagt
cctgaggatgcccctgagtccattagcaaagcagttgccagtcttccaccagagcagatg
tttgaactgatgaaacaaatgaagctctgtgtccagaatagtccccaggaagcacggaac
atgttacttcagaatcctcagctggcatatgctttgctgcaagcacaggtagtgatgaga
atcgtggatccagagattgccctgaaaattctgcatcgccagacaaatatcccaacactg
attgcaggcaacccccaaccagtccatggtgctggacctggctctggatccagtgtatcg
atgaaccagccaaatcctcagggccctcagccccaatctttgggtggaatgcacgtcaat
ggcgcacctcctctgatgcaagcttctatgccaggtggtgttccagcaccagggcagatg
gccgctgctgtcacaggacctggccctggttccttagctcctggaggaggaatgcagact
caggttggaatgccaggaggtggaccagtgcccatggaacgaggacaagtgccgatgcaa
gaccccagagcagctctacagcggggctctttgcctgccaatgtcccaactcctcgaggt
ctcttaggagatgctccaaatgacccacggggaggcactttactttctgtaactggagac
gtagagcctagaggttacctgggaccacctcatcagggtccacccatgcaccacgtccct
ggtcatgaaagccgtggcccaccaccacatgagatgagaggagggccactagctgaacct
agacctctaatggcagagccaagaggacccatgctagatcagaggggtccacctttggat
ggcagaggtggacgagatccacgaggcatagatgcacgaagtatggaggcccgagccatg
gaggcaagaggattagatgcacgaagtatggaggccagagcaatggaagcccgtgccatg
gaggcccgtgccatggaggcccgtgccatggaggtccgtgctatggaagtccgaggaatg
gaggctagaggcatggacaccaggggcccagtgcccggacctagaggacctctgcctagt
ggaatgccaggtcccgctccaatgaatatggcggttggtccccagggagccagacaggtc
ccagtcatgcagggagcaggcatgcaaggagcaagcctgcagggtggaagccagcctggt
gcctttagtcctgggcagaaccaagtcactccacaggatcatgagaaggctgctttgatt
atgcaggttcttcagctgactgcagaccagattgccatgctgccaccggagcaaaggcag
agtatcctaatcttaaaggaacaaatccagaaatccactggagcgccttaa

KEGG   Oryctolagus cuniculus (rabbit): 100344475
Entry
100344475         CDS       T03373                                 

Definition
(RefSeq) cleavage stimulation factor subunit 2 tau variant-like
  KO
K14407  cleavage stimulation factor subunit 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100344475
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100344475
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage stimulation factor (CSTF) complex
     100344475
SSDB
Motif
Pfam: CSTF2_hinge RRM_1 CSTF_C RRM_Rrp7 RRM_7
Other DBs
NCBI-GeneID: 100344475
NCBI-ProteinID: XP_008256943
LinkDB
Position
7
AA seq 600 aa
MSSLAVRDLAMDRSLRSMFVGNIPYEATEEQLKDIFSEVGSVVSFRLVYDREMGKPKGYG
FCEYQDQETALSAMRNLNEREFSGRALRVDNAASEKNKEELKSLGPAAPIIDSPYGDPID
PEDAPESITRAVASLPPEQMFELMKQMKLCXQNSHQEARNMLLQNPQLAYALLQAQVVMR
IMDPEIALKILHRKIHVTPLIPGKSQPVAGPVPDPVPGPGXCPAPNVLLNQQNPPAPQPQ
HLARRPIKDIPPLMQTPIQGGIPAPGPIPAAVPGPGPGALAPGGAMQPQVGMPGVGLVPL
ERGQVQMSDPRAPMPHGPMTAGGLPPRGLLGDAPNDPRGGTLLSVTGEVESRGYLGPPHQ
GPPMHHPSGHDGRGPSSHEMRGGPLGDPRMLIGEPRGPMLDQRGLPMDGRVSRDSRVMET
RAMETDVLESRVMERRGMETCAMEARGMDTRGLEMRGPVPSSRGHMTGGMPGPGPINIGA
AGPQGPRQVPSISSVGNPGGGMQGAGVQGAGMQGGGMQGAGMQGVGIQGAGMQGAGKQGA
SQPSSFSPGQSQVTPQDQEKAALITQVLQLTADQIAMLPPEQRQSILILKEQIQKSTGAS
NT seq 1803 nt   +upstreamnt  +downstreamnt
atgtcgagtttagcggtgagagacctggccatggatcgatcactgcgttccatgttcgtg
gggaacattccgtatgaggcgactgaggagcagttaaaggacattttctccgaggtcggt
tcggtggtcagtttccggctggtgtacgatagagagatgggaaaacctaagggttatggc
ttctgtgagtaccaagaccaggagaccgcgcttagtgccatgcggaacctcaatgagcgg
gagttcagtgggcgagcacttcgggtggacaatgctgccagtgagaagaataaggaggag
ttaaagagcctggggcctgcggcacccatcattgactcaccctatggggaccccatcgat
ccagaagatgcccctgaatcgattaccagagcggtcgccagtctccccccggagcagatg
tttgagctgatgaagcagatgaagctctgtnngcaaaacagtcaccaggaagcgcgcaac
atgctacttcaaaacccgcagctggcttacgcgctgctgcaggcgcaagtggtgatgaga
atcatggatccagagattgctctgaaaattctgcatcggaaaatacacgtcacaccgctg
atcccaggcaaatctcagcccgtcgctggccctgtgccggaccccgtgccgggccccggc
ncctgcccagcaccgaatgttctgctgaatcagcagaatcctccagcccctcagcctcag
catttggctagaagaccaatcaaagacattcctcctctgatgcagactcccatccaaggt
ggaattccagctcccggacccataccagcggcagtccccggccctggccctggcgcctta
gctcccggaggagcaatgcaaccccaagtcggaatgccaggggttggcctagtgccttta
gagcggggacaagtgcagatgtcagatcctagagctcctatgccgcatggacccatgact
gccggcggcctgcctccccgcggactgctgggagatgctccaaatgacccacgtggaggg
acgctgctttcagtcactggagaagtggagtctcgaggttacctgggcccaccccatcag
ggtccccccatgcaccatccctctggtcatgacggccgcggcccttcctcacatgagatg
aggggagggccgttaggagaccccagaatgctaattggagaacccagaggacccatgttg
gatcaaaggggtttacctatggatggtagagttagtagagattctcgagtgatggagact
cgagccatggaaactgatgtcttagagtcacgagtgatggaaagaagaggcatggagact
tgtgcaatggaagccagaggcatggatacaagaggactggagatgaggggccccgtcccc
agttcgcgaggccatatgaccggtggaatgccaggccctgggcccattaacataggggca
gctggccctcagggacccagacaggtcccaagcatttccagtgtggggaatcctggaggt
ggcatgcagggggcgggcgtgcagggagcgggcatgcaaggaggaggaatgcagggggca
ggcatgcaaggagtgggcatccaaggagcaggtatgcagggggcaggtaagcaaggtgca
agccagcctagcagttttagtcctgggcagagccaggtaactccacaggaccaagaaaag
gcagctttgattacgcaggttcttcagctaactgcagatcagattgccatgctacctcct
gagcaaaggcagagtattctgattttaaaggagcaaatccagaaatccactggagcttcc
taa

KEGG   Oryctolagus cuniculus (rabbit): 100357418
Entry
100357418         CDS       T03373                                 

Gene name
CSTF2T
Definition
(RefSeq) cleavage stimulation factor subunit 2 tau variant
  KO
K14407  cleavage stimulation factor subunit 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100357418 (CSTF2T)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100357418 (CSTF2T)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage stimulation factor (CSTF) complex
     100357418 (CSTF2T)
SSDB
Motif
Pfam: CSTF2_hinge RRM_1 CSTF_C RRM_7 RRM_occluded RRM_Rrp7
Other DBs
NCBI-GeneID: 100357418
NCBI-ProteinID: XP_002718535
UniProt: A0A5F9DGK0
LinkDB
Position
18
AA seq 601 aa
MSSLAVRDPAMDRSLRSVFVGNIPYEATEEQLKDIFSEVGSVVSFRLVYDRETGKPKGYG
FCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGPAAPIIDSPYGDPID
PEDAPESITRAVASLPPEQMFELMKQMKLCVQNSHQEARNMLLQNPQLAYALLQAQVVMR
IMDPEIALKILHRKIHVTPLIPGKSQPVAGPVPGPVPGPGPAPGLCPALLNQQNPPAPQP
QHLARRPVKDIPPLMQTPIQGGIPAPGPIPAAVPGPGPGALAPGGAMQPQVGMPGVGPVP
LERGQVQMSDPRAPMPRGPMTAGGLPPRGLLGDAPNDPRGGTLLSVTGEVEPRGYLGPPH
QGPPMHHPSGHDGRGPSSHEMRGGPLGDPRMLIGEPRGPMLDQRGLPMDGRVSRDSRVME
TRAMETDVLESRVMERRGMETCAMEARGMDTRGLEMRGPVPSSRGHMTGGMPGPGPINIG
AAGPQGPRQVPSISSVGNPGGGMQGAGVQGAGMQGGGMQGAGMQGVGIQGAGMQGAGKQG
GSQPSSFSPGQSQVTPQDQEKAALIMQVLQLTADQIAMLPPEQRQSILILKEQIQKSTGA
S
NT seq 1806 nt   +upstreamnt  +downstreamnt
atgtcgagtttagcggtgagagacccggccatggatcgatcactgcgttccgtgttcgtg
gggaacattccgtatgaggcgactgaggagcagttaaaggacattttctccgaggtcggt
tcggtggtcagtttccggctggtgtacgacagagagacgggaaaacctaagggttatggc
ttctgtgagtaccaagaccaggagaccgcgcttagtgccatgcggaacctcaatgggcgg
gagttcagtgggcgagcgcttcgggtggacaatgctgccagtgagaagaataaggaggag
ttaaagagcctggggcctgcagcacccatcattgactcaccctatggggaccccatcgat
ccagaagatgcccctgaatcgattaccagagcggtcgccagtctccccccggagcagatg
tttgagctgatgaagcagatgaagctctgtgtgcaaaacagtcaccaggaagcgcgcaac
atgctacttcaaaacccgcagctggcttacgcgctgctgcaggcgcaagtggtgatgaga
atcatggatccagagattgctctgaaaattctgcatcggaaaatacacgtcacaccgctg
atcccaggcaaatctcagcccgtcgctggccctgtgccgggccccgtgccgggccctggc
cctgcccctgggctctgcccagcgctgctgaatcagcagaatcctccagcccctcagcct
cagcatttggctagaagaccagtcaaagacattcctcctctgatgcagactcccatccaa
ggtggaattccagctcccggacccataccagcggcagtccccggccctggccctggcgcc
ttagctcccggaggagcaatgcaaccccaagtcggaatgccaggggttggcccagtgcct
ttagagcggggacaagtgcagatgtcagatcccagagctcctatgccgcgtggacccatg
actgctggcggcctgcctccccgcggactgctgggagatgctccaaatgacccacgtgga
gggactttgctttcagtcactggagaagtggagcctcgaggttacctgggcccaccccat
cagggtccccccatgcaccatccctctggtcatgacggccgcggcccttcctcacatgag
atgaggggagggccgttaggagaccccagaatgctaattggagaacccagaggacccatg
ttggatcaaaggggtttacctatggacggtagagttagtagagattctcgagtgatggag
actcgagccatggaaactgatgtcttggagtcacgagtgatggagagaagaggcatggag
acttgtgcaatggaagccagaggcatggatacaaggggactggagatgaggggccccgtc
cccagttcgcgaggccatatgaccggtggaatgccaggccctgggcccattaacataggg
gcagctggccctcagggacccagacaggtcccaagcatttccagtgtggggaatcctgga
ggtggcatgcagggggcgggcgtgcagggagcgggcatgcaaggaggaggaatgcagggg
gcaggcatgcaaggagtgggcatccaaggagcaggtatgcagggggcaggtaagcaaggt
ggaagccagcctagcagttttagtcctgggcagagccaggtaactccacaggaccaagaa
aaggcagctttgattatgcaggttcttcagctaactgcagatcagattgccatgctacct
cctgagcaaaggcagagtattctgattttaaaggagcaaatccagaaatccactggagct
tcctga

DBGET integrated database retrieval system