KEGG   Oryctolagus cuniculus (rabbit): 100342335Help
Entry
100342335         CDS       T03373                                 

Gene name
PHF11
Definition
(RefSeq) histone-lysine N-methyltransferase SETDB2
  KO
K18494  histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100342335 (PHF11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ocu03036]
    100342335 (PHF11)
Enzymes [BR:ocu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100342335 (PHF11)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100342335 (PHF11)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100342335 (PHF11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET MBD Pectinesterase
Motif
Other DBs
NCBI-GeneID: 100342335
NCBI-ProteinID: XP_008272058
Ensembl: ENSOCUG00000003755 ENSOCUG00000003761
LinkDB All DBs
Position
Un
AA seq 702 aa AA seqDB search
MGEKNGDAKTFWMELEDHGKVDFIFEQVQNVLQSLKQKIKDGSATNKEYIQAMILVNEAT
LNNNFSLVKGHIPVTENEKGNKSQSFPSTSCENLFPEDSTFPSTGNKEILPLENKVVGLR
ARKSSLHLSYQSHDCSRACLVKMPSFKGENPLQLPIKCHFQRRHAKTNSHSSALHVSYKT
PCGRSLRNVEEVFRYLLETECNFLFTDNFSFNTYVQLTRNYPKQEEIVSDVDISNGVESV
PISFCNEIDSRKLPQFKYRKTMWPRTYYLNSFSNMFTDACDCSEGCIDITKCACLQLTAR
NAAVCPLSSNKIMTGYKYKRLQRQIPTGIYECSLLCKCNRQMCQNRVVQHGPQVRLQVFK
TEKKGWGVRCLDDIDRGTFVCTYSGRLLSRANFEKPGNENEKEENIVKSIFSKKRKIEVA
CSECEVEVIPLELETHPRSAESEDCSPKFSNNSKESIMETKCNNISGTPYHSVTKSPKSK
TAVFQHNEKKMGFVSSESVSLEGSDGFKPNQEYLNSRVGRVQKESSSKQVEDSEENPLIE
SDVIDITKCSEETPPRDGCNQTTTLINQNTKNEVQIQKPQMKKSTTYQNQQLFCVDELPS
ETKSTSSDSPTKFSKENMFLLDATKEGNVGRFLNHSCCPNLLVQNVFVETHDRNFPLVAF
FTNRYVKARTELTWDYGYEAGTVPEKEIICHCGVNKCRKKIL
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaaaaaatggtgatgcaaaaactttctggatggagctggaagatcatggaaaa
gtagactttatttttgaacaagtgcagaatgtgctgcagtcactgaaacagaagatcaaa
gatggctctgccacaaataaagaatatatccaagcaatgatcctagtgaatgaagcaact
ctaaataacaatttttcattggtaaagggtcatatacctgtgactgagaatgaaaaggga
aacaaatcacaatcatttccctctacatcctgtgaaaacttgtttcctgaagacagtaca
tttccatctacaggaaacaaagagattcttcctctggaaaataaagttgtaggcttgaga
gcaagaaaatcatctttgcatttatcttaccaaagtcatgattgctctcgtgcctgtctg
gtgaaaatgccaagcttcaaaggagaaaaccctctacagcttccaatcaagtgtcacttc
caaaggcgacacgcgaagacaaactctcattcgtcagcactccatgtgagttataaaact
ccttgtggaaggagtctacgaaacgtggaggaagtttttcgttacctgcttgagacagag
tgtaactttttatttacagataacttttctttcaatacctatgttcagttgactcggaat
tacccaaagcaagaagaaattgtttctgatgtggatattagcaatggagtggagtcagtg
cccatttctttctgtaacgaaattgacagtagaaagcttccacagtttaagtacagaaag
actatgtggccacgaacttattatctaaacagcttttccaacatgtttactgatgcatgt
gactgttctgagggctgcatagacataacaaaatgtgcatgtcttcaactgacagcaaga
aatgccgcagtttgtcctttgtcaagtaataaaataatgactggatataaatataaaaga
ctacagagacaaatacctactggtatttatgaatgcagcctgttgtgcaagtgtaatcga
caaatgtgtcaaaatcgagttgtccaacatggtcctcaagtgagactacaggttttcaaa
actgagaagaaaggctggggggtacgctgcctagatgacattgacagagggacatttgtt
tgcacttactcaggtagattactaagcagagctaactttgagaaacctggtaatgaaaat
gaaaaagaagagaatattgtgaaaagtatattttcaaaaaagaggaaaatagaagttgcc
tgttcagagtgtgaggttgaagttattccattagaattggaaacacatcctagaagtgct
gaaagtgaggactgttcacctaaattcagtaataattccaaagagtctattatggaaaca
aagtgcaacaacatctcaggaactccgtatcattcagttactaaaagtcctaaatccaag
acagctgtttttcaacacaatgagaaaaagatgggatttgtttcctcggaatctgtctcc
ttggagggtagtgatggatttaaaccaaaccaagaatatctgaactccagagtcggcaga
gtgcaaaaagagtcaagttcaaaacaagttgaagattctgaagagaatcctctgattgaa
tcagatgtgatagatataactaaatgttcagaagagactccaccaagggacggatgtaac
caaacaactacattgattaatcaaaatactaaaaatgaggttcaaatacagaagccccaa
atgaaaaaatctacaacatatcaaaatcagcagctcttttgtgttgatgagttgccaagt
gaaaccaagagcacttcatctgattctccaacaaagttcagtaaagagaatatgttttta
ttggatgccacaaaagaaggaaatgtgggccgcttccttaaccatagttgttgcccaaat
ctcttggtacagaatgtttttgtagaaacacacgacaggaattttccattggtggcattc
ttcaccaacaggtatgtgaaagcaagaacagaactaacctgggattatggttatgaagct
ggaactgtacctgagaaggaaatcatctgccattgtggggttaacaagtgtagaaaaaaa
atactatga

DBGET integrated database retrieval system