KEGG   Oryctolagus cuniculus (rabbit): 100342436
Entry
100342436         CDS       T03373                                 

Gene name
PYM1, WIBG
Definition
(RefSeq) PYM homolog 1, exon junction complex associated factor
  KO
K14294  partner of Y14 and mago
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03013  RNA transport
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100342436 (PYM1)
   03015 mRNA surveillance pathway
    100342436 (PYM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100342436 (PYM1)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     100342436 (PYM1)
SSDB
Motif
Pfam: Mago-bind Nif11 VirC2
Other DBs
NCBI-GeneID: 100342436
NCBI-ProteinID: XP_008254838
UniProt: A0A5F9C3X1
LinkDB
Position
4
AA seq 204 aa
MEAAGKPEAAGTGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYVKFFKSKPELP
PGLSPEATAPAAPSRPEGGEPGLSKTAKRNLKRKEKRRQQQEKGDAEALSRTLEKVSVGD
TARPPSAPQGSQAAPTAASEQPDPAATTEKAKKIKNLKKKLRQVEELQQRIQAGEVSQPS
REQLEKLARRRALEEELEDLELGL
NT seq 615 nt   +upstreamnt  +downstreamnt
atggaagctgccggcaagcccgaggctgcggggacaggcaagtacatcgcctcaacacag
cgacccgacgggacctggcgcaagcagcggagggtcaaagaaggctacgtgccccaggag
gaggtcccagtctatgaaaacaagtatgtcaagtttttcaagagtaaaccagaactgccc
ccagggctgagccctgaggccactgctcctgccgccccgtccaggcctgaaggtggtgag
ccaggcctctctaagacagccaaacgcaacctgaagcggaaggagaagaggcggcagcaa
caagaaaaaggagatgcagaggccttgagccggactcttgagaaggtgtccgtgggagac
acagcccgaccccccagtgctccacagggctcccaggcagcccccacagctgcctctgag
cagcccgacccagctgccaccaccgagaaagccaagaagataaagaacctaaagaagaag
ctccgtcaggtggaggagctgcagcagcgaatccaggctggggaggtcagccagcccagc
agagagcagctggagaagctggcgaggaggagggcgctggaggaggagctggaggacttg
gagcttggcctgtga

DBGET integrated database retrieval system