KEGG   Oryctolagus cuniculus (rabbit): 100342787
Entry
100342787         CDS       T03373                                 

Gene name
NUDT21
Definition
(RefSeq) nudix hydrolase 21
  KO
K14397  cleavage and polyadenylation specificity factor subunit 5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100342787 (NUDT21)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100342787 (NUDT21)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Pre-mRNA cleavage factor Im (CFIm)
     100342787 (NUDT21)
SSDB
Motif
Pfam: NUDIX_2
Other DBs
NCBI-GeneID: 100342787
NCBI-ProteinID: XP_002711573
Ensembl: ENSOCUG00000017224
UniProt: G1TD91
LinkDB
Position
5
AA seq 227 aa
MSVVPPNRSQTGWPRGVNQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSV
AARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEG
LKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQ
EKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN
NT seq 684 nt   +upstreamnt  +downstreamnt
atgtcggtggtaccgcccaatcgctcgcagaccggctggccccgcggggtcaatcagttc
ggcaacaagtacatccagcagaccaagcccctcaccctggagcgcaccatcaacctttat
cctcttaccaattatacttttggtacaaaagagcctctctatgagaaggacagttctgtt
gcagccagatttcagcgcatgcgggaagaatttgataaaattggaatgaggaggactgta
gaaggggttctgattgtacacgagcaccggctaccccatgtgttactgctacaactggga
acaactttcttcaaattacctggtggtgaacttaacccaggagaagatgaagttgaagga
ctaaaacgcttaatgacagagatactaggccgccaagatggagttctgcaagactgggtc
attgatgactgcattggtaactggtggagaccaaattttgaacctcctcagtatccatat
attcctgcacatattacaaagcctaaggaacataagaagttgtttctggttcaacttcaa
gagaaagccttgtttgcagtccctaaaaattacaagctggtagctgcaccattgtttgaa
ttgtatgacaatgcaccaggatatggacccatcatttctagtctccctcagctgttgagc
aggttcaattttatatacaactga

DBGET integrated database retrieval system