KEGG   Oryctolagus cuniculus (rabbit): 100342852
Entry
100342852         CDS       T03373                                 

Gene name
AKT2
Definition
(RefSeq) AKT serine/threonine kinase 2
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu01522  Endocrine resistance
ocu01524  Platinum drug resistance
ocu04010  MAPK signaling pathway
ocu04012  ErbB signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04024  cAMP signaling pathway
ocu04062  Chemokine signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04068  FoxO signaling pathway
ocu04071  Sphingolipid signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04140  Autophagy - animal
ocu04150  mTOR signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04152  AMPK signaling pathway
ocu04210  Apoptosis
ocu04211  Longevity regulating pathway
ocu04213  Longevity regulating pathway - multiple species
ocu04218  Cellular senescence
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04370  VEGF signaling pathway
ocu04371  Apelin signaling pathway
ocu04380  Osteoclast differentiation
ocu04510  Focal adhesion
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04611  Platelet activation
ocu04620  Toll-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04660  T cell receptor signaling pathway
ocu04662  B cell receptor signaling pathway
ocu04664  Fc epsilon RI signaling pathway
ocu04666  Fc gamma R-mediated phagocytosis
ocu04668  TNF signaling pathway
ocu04722  Neurotrophin signaling pathway
ocu04725  Cholinergic synapse
ocu04728  Dopaminergic synapse
ocu04910  Insulin signaling pathway
ocu04914  Progesterone-mediated oocyte maturation
ocu04915  Estrogen signaling pathway
ocu04917  Prolactin signaling pathway
ocu04919  Thyroid hormone signaling pathway
ocu04920  Adipocytokine signaling pathway
ocu04922  Glucagon signaling pathway
ocu04923  Regulation of lipolysis in adipocytes
ocu04926  Relaxin signaling pathway
ocu04929  GnRH secretion
ocu04931  Insulin resistance
ocu04932  Non-alcoholic fatty liver disease
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu04935  Growth hormone synthesis, secretion and action
ocu04973  Carbohydrate digestion and absorption
ocu05010  Alzheimer disease
ocu05017  Spinocerebellar ataxia
ocu05132  Salmonella infection
ocu05135  Yersinia infection
ocu05142  Chagas disease
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05210  Colorectal cancer
ocu05211  Renal cell carcinoma
ocu05212  Pancreatic cancer
ocu05213  Endometrial cancer
ocu05214  Glioma
ocu05215  Prostate cancer
ocu05218  Melanoma
ocu05220  Chronic myeloid leukemia
ocu05221  Acute myeloid leukemia
ocu05222  Small cell lung cancer
ocu05223  Non-small cell lung cancer
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05230  Central carbon metabolism in cancer
ocu05231  Choline metabolism in cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100342852 (AKT2)
   04012 ErbB signaling pathway
    100342852 (AKT2)
   04014 Ras signaling pathway
    100342852 (AKT2)
   04015 Rap1 signaling pathway
    100342852 (AKT2)
   04370 VEGF signaling pathway
    100342852 (AKT2)
   04371 Apelin signaling pathway
    100342852 (AKT2)
   04630 JAK-STAT signaling pathway
    100342852 (AKT2)
   04668 TNF signaling pathway
    100342852 (AKT2)
   04066 HIF-1 signaling pathway
    100342852 (AKT2)
   04068 FoxO signaling pathway
    100342852 (AKT2)
   04072 Phospholipase D signaling pathway
    100342852 (AKT2)
   04071 Sphingolipid signaling pathway
    100342852 (AKT2)
   04024 cAMP signaling pathway
    100342852 (AKT2)
   04022 cGMP-PKG signaling pathway
    100342852 (AKT2)
   04151 PI3K-Akt signaling pathway
    100342852 (AKT2)
   04152 AMPK signaling pathway
    100342852 (AKT2)
   04150 mTOR signaling pathway
    100342852 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100342852 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    100342852 (AKT2)
   04218 Cellular senescence
    100342852 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100342852 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    100342852 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100342852 (AKT2)
   04620 Toll-like receptor signaling pathway
    100342852 (AKT2)
   04625 C-type lectin receptor signaling pathway
    100342852 (AKT2)
   04660 T cell receptor signaling pathway
    100342852 (AKT2)
   04662 B cell receptor signaling pathway
    100342852 (AKT2)
   04664 Fc epsilon RI signaling pathway
    100342852 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    100342852 (AKT2)
   04062 Chemokine signaling pathway
    100342852 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100342852 (AKT2)
   04922 Glucagon signaling pathway
    100342852 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    100342852 (AKT2)
   04920 Adipocytokine signaling pathway
    100342852 (AKT2)
   04929 GnRH secretion
    100342852 (AKT2)
   04915 Estrogen signaling pathway
    100342852 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    100342852 (AKT2)
   04917 Prolactin signaling pathway
    100342852 (AKT2)
   04926 Relaxin signaling pathway
    100342852 (AKT2)
   04935 Growth hormone synthesis, secretion and action
    100342852 (AKT2)
   04919 Thyroid hormone signaling pathway
    100342852 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100342852 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100342852 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    100342852 (AKT2)
   04728 Dopaminergic synapse
    100342852 (AKT2)
   04722 Neurotrophin signaling pathway
    100342852 (AKT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100342852 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    100342852 (AKT2)
   04213 Longevity regulating pathway - multiple species
    100342852 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100342852 (AKT2)
   05205 Proteoglycans in cancer
    100342852 (AKT2)
   05230 Central carbon metabolism in cancer
    100342852 (AKT2)
   05231 Choline metabolism in cancer
    100342852 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100342852 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100342852 (AKT2)
   05212 Pancreatic cancer
    100342852 (AKT2)
   05225 Hepatocellular carcinoma
    100342852 (AKT2)
   05226 Gastric cancer
    100342852 (AKT2)
   05214 Glioma
    100342852 (AKT2)
   05221 Acute myeloid leukemia
    100342852 (AKT2)
   05220 Chronic myeloid leukemia
    100342852 (AKT2)
   05218 Melanoma
    100342852 (AKT2)
   05211 Renal cell carcinoma
    100342852 (AKT2)
   05215 Prostate cancer
    100342852 (AKT2)
   05213 Endometrial cancer
    100342852 (AKT2)
   05224 Breast cancer
    100342852 (AKT2)
   05222 Small cell lung cancer
    100342852 (AKT2)
   05223 Non-small cell lung cancer
    100342852 (AKT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100342852 (AKT2)
   05017 Spinocerebellar ataxia
    100342852 (AKT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100342852 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100342852 (AKT2)
   04931 Insulin resistance
    100342852 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100342852 (AKT2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100342852 (AKT2)
   05135 Yersinia infection
    100342852 (AKT2)
   05152 Tuberculosis
    100342852 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100342852 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    100342852 (AKT2)
   05162 Measles
    100342852 (AKT2)
   05164 Influenza A
    100342852 (AKT2)
   05161 Hepatitis B
    100342852 (AKT2)
   05160 Hepatitis C
    100342852 (AKT2)
   05168 Herpes simplex virus 1 infection
    100342852 (AKT2)
   05163 Human cytomegalovirus infection
    100342852 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100342852 (AKT2)
   05169 Epstein-Barr virus infection
    100342852 (AKT2)
   05165 Human papillomavirus infection
    100342852 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100342852 (AKT2)
   05142 Chagas disease
    100342852 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100342852 (AKT2)
   01524 Platinum drug resistance
    100342852 (AKT2)
   01522 Endocrine resistance
    100342852 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100342852 (AKT2)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100342852 (AKT2)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100342852 (AKT2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11
Other DBs
NCBI-GeneID: 100342852
NCBI-ProteinID: XP_017194786
LinkDB
Position
Un
AA seq 479 aa
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERSEALDQTLLSLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRGPGEDPM
DYKCGSPSDSSAAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFE
LILMEEIRFPRTLGPEAKALLAGLLKKDPKLGGGPSDAKEVMEHRFFLSVDWQDVVHRKL
LPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGSLELDQRTHFPQFSYSASIRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgaacgaggtgtctgtcatcaaagaaggctggctccacaagcgcggtgaatacatcaag
acctggaggccccggtacttcctgctcaagagtgacggctccttcattgggtacaaggag
aggtctgaggctctcgaccagaccttactctctttaaacaacttctccgtagcagaatgc
cagctgatgaagaccgagaggccacggcccaacaccttcgtcatccgctgcctgcagtgg
accacggtcattgagaggactttccacgtggactccccagacgagcgggaggagtggatg
cgggccatccagatggtcgccaacagcctcaagcagcggggcccgggcgaggaccccatg
gactacaagtgtggctcccccagcgactcctccgctgctgaggagatggaagtggcggtc
agcaaggctcgggccaaggtgaccatgaacgacttcgactatctcaaactcctgggcaag
ggcaccttcggcaaagtcatcctggtgcgggagaaggccaccggccgctactacgccatg
aagatcctgcggaaagaggtcatcatcgccaaggatgaagtcgcccacacggtgaccgag
agccgcgtcctccagaacaccaggcacccgttcctcacagcgctgaagtacgcattccag
acccatgaccgcctgtgtttcgtgatggagtacgccaatggcggagagctgttcttccac
ctgtcccgggagcgcgtcttcacggaggagcgggcgcggttctacggtgcggaaatcgtc
tcggctctcgagtacctgcactcgcgggatgtggtctaccgcgacatcaagctggaaaac
ctcatgctggacaaagacggccacatcaagatcactgacttcggcctgtgcaaagagggc
atcagcgacggggccaccatgaagaccttctgcgggacgcccgagtacctggcccctgag
gtgctggaggacaacgactacggccgggcggtggactggtgggggctgggcgtggtcatg
tacgagatgatgtgcggccgcctgcccttctacaaccaggaccacgagaagctgttcgag
ctcatcctcatggaggagatccgcttcccgcgcacgctgggccccgaggccaaggccctg
ctcgccgggctgctcaagaaggaccccaagctcggtggggggcccagtgacgccaaggag
gtcatggagcacaggttcttcctcagcgtcgactggcaggacgtggtgcacaggaagctc
ctgccgcccttcaagccccaggtcacctccgaggtcgacacgcggtacttcgacgacgag
ttcaccgcgcagtccatcacaatcacaccccccgaccgctatgacagcctgggctcgctg
gagctggaccagcggacgcacttcccccagttctcctactcggccagcatccgcgagtga

KEGG   Oryctolagus cuniculus (rabbit): 100353706
Entry
100353706         CDS       T03373                                 

Gene name
AKT3
Definition
(RefSeq) AKT serine/threonine kinase 3
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu01522  Endocrine resistance
ocu01524  Platinum drug resistance
ocu04010  MAPK signaling pathway
ocu04012  ErbB signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04024  cAMP signaling pathway
ocu04062  Chemokine signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04068  FoxO signaling pathway
ocu04071  Sphingolipid signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04140  Autophagy - animal
ocu04150  mTOR signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04152  AMPK signaling pathway
ocu04210  Apoptosis
ocu04211  Longevity regulating pathway
ocu04213  Longevity regulating pathway - multiple species
ocu04218  Cellular senescence
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04370  VEGF signaling pathway
ocu04371  Apelin signaling pathway
ocu04380  Osteoclast differentiation
ocu04510  Focal adhesion
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04611  Platelet activation
ocu04620  Toll-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04660  T cell receptor signaling pathway
ocu04662  B cell receptor signaling pathway
ocu04664  Fc epsilon RI signaling pathway
ocu04666  Fc gamma R-mediated phagocytosis
ocu04668  TNF signaling pathway
ocu04722  Neurotrophin signaling pathway
ocu04725  Cholinergic synapse
ocu04728  Dopaminergic synapse
ocu04910  Insulin signaling pathway
ocu04914  Progesterone-mediated oocyte maturation
ocu04915  Estrogen signaling pathway
ocu04917  Prolactin signaling pathway
ocu04919  Thyroid hormone signaling pathway
ocu04920  Adipocytokine signaling pathway
ocu04922  Glucagon signaling pathway
ocu04923  Regulation of lipolysis in adipocytes
ocu04926  Relaxin signaling pathway
ocu04929  GnRH secretion
ocu04931  Insulin resistance
ocu04932  Non-alcoholic fatty liver disease
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu04935  Growth hormone synthesis, secretion and action
ocu04973  Carbohydrate digestion and absorption
ocu05010  Alzheimer disease
ocu05017  Spinocerebellar ataxia
ocu05132  Salmonella infection
ocu05135  Yersinia infection
ocu05142  Chagas disease
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05210  Colorectal cancer
ocu05211  Renal cell carcinoma
ocu05212  Pancreatic cancer
ocu05213  Endometrial cancer
ocu05214  Glioma
ocu05215  Prostate cancer
ocu05218  Melanoma
ocu05220  Chronic myeloid leukemia
ocu05221  Acute myeloid leukemia
ocu05222  Small cell lung cancer
ocu05223  Non-small cell lung cancer
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05230  Central carbon metabolism in cancer
ocu05231  Choline metabolism in cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100353706 (AKT3)
   04012 ErbB signaling pathway
    100353706 (AKT3)
   04014 Ras signaling pathway
    100353706 (AKT3)
   04015 Rap1 signaling pathway
    100353706 (AKT3)
   04370 VEGF signaling pathway
    100353706 (AKT3)
   04371 Apelin signaling pathway
    100353706 (AKT3)
   04630 JAK-STAT signaling pathway
    100353706 (AKT3)
   04668 TNF signaling pathway
    100353706 (AKT3)
   04066 HIF-1 signaling pathway
    100353706 (AKT3)
   04068 FoxO signaling pathway
    100353706 (AKT3)
   04072 Phospholipase D signaling pathway
    100353706 (AKT3)
   04071 Sphingolipid signaling pathway
    100353706 (AKT3)
   04024 cAMP signaling pathway
    100353706 (AKT3)
   04022 cGMP-PKG signaling pathway
    100353706 (AKT3)
   04151 PI3K-Akt signaling pathway
    100353706 (AKT3)
   04152 AMPK signaling pathway
    100353706 (AKT3)
   04150 mTOR signaling pathway
    100353706 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100353706 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    100353706 (AKT3)
   04218 Cellular senescence
    100353706 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100353706 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    100353706 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100353706 (AKT3)
   04620 Toll-like receptor signaling pathway
    100353706 (AKT3)
   04625 C-type lectin receptor signaling pathway
    100353706 (AKT3)
   04660 T cell receptor signaling pathway
    100353706 (AKT3)
   04662 B cell receptor signaling pathway
    100353706 (AKT3)
   04664 Fc epsilon RI signaling pathway
    100353706 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    100353706 (AKT3)
   04062 Chemokine signaling pathway
    100353706 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100353706 (AKT3)
   04922 Glucagon signaling pathway
    100353706 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    100353706 (AKT3)
   04920 Adipocytokine signaling pathway
    100353706 (AKT3)
   04929 GnRH secretion
    100353706 (AKT3)
   04915 Estrogen signaling pathway
    100353706 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    100353706 (AKT3)
   04917 Prolactin signaling pathway
    100353706 (AKT3)
   04926 Relaxin signaling pathway
    100353706 (AKT3)
   04935 Growth hormone synthesis, secretion and action
    100353706 (AKT3)
   04919 Thyroid hormone signaling pathway
    100353706 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100353706 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100353706 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    100353706 (AKT3)
   04728 Dopaminergic synapse
    100353706 (AKT3)
   04722 Neurotrophin signaling pathway
    100353706 (AKT3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100353706 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    100353706 (AKT3)
   04213 Longevity regulating pathway - multiple species
    100353706 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100353706 (AKT3)
   05205 Proteoglycans in cancer
    100353706 (AKT3)
   05230 Central carbon metabolism in cancer
    100353706 (AKT3)
   05231 Choline metabolism in cancer
    100353706 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100353706 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100353706 (AKT3)
   05212 Pancreatic cancer
    100353706 (AKT3)
   05225 Hepatocellular carcinoma
    100353706 (AKT3)
   05226 Gastric cancer
    100353706 (AKT3)
   05214 Glioma
    100353706 (AKT3)
   05221 Acute myeloid leukemia
    100353706 (AKT3)
   05220 Chronic myeloid leukemia
    100353706 (AKT3)
   05218 Melanoma
    100353706 (AKT3)
   05211 Renal cell carcinoma
    100353706 (AKT3)
   05215 Prostate cancer
    100353706 (AKT3)
   05213 Endometrial cancer
    100353706 (AKT3)
   05224 Breast cancer
    100353706 (AKT3)
   05222 Small cell lung cancer
    100353706 (AKT3)
   05223 Non-small cell lung cancer
    100353706 (AKT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100353706 (AKT3)
   05017 Spinocerebellar ataxia
    100353706 (AKT3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100353706 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100353706 (AKT3)
   04931 Insulin resistance
    100353706 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100353706 (AKT3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100353706 (AKT3)
   05135 Yersinia infection
    100353706 (AKT3)
   05152 Tuberculosis
    100353706 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100353706 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    100353706 (AKT3)
   05162 Measles
    100353706 (AKT3)
   05164 Influenza A
    100353706 (AKT3)
   05161 Hepatitis B
    100353706 (AKT3)
   05160 Hepatitis C
    100353706 (AKT3)
   05168 Herpes simplex virus 1 infection
    100353706 (AKT3)
   05163 Human cytomegalovirus infection
    100353706 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100353706 (AKT3)
   05169 Epstein-Barr virus infection
    100353706 (AKT3)
   05165 Human papillomavirus infection
    100353706 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100353706 (AKT3)
   05142 Chagas disease
    100353706 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100353706 (AKT3)
   01524 Platinum drug resistance
    100353706 (AKT3)
   01522 Endocrine resistance
    100353706 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100353706 (AKT3)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100353706 (AKT3)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100353706 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like FTA2 PH_11
Other DBs
NCBI-GeneID: 100353706
NCBI-ProteinID: XP_002717694
Ensembl: ENSOCUG00000015901
LinkDB
Position
16
AA seq 479 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGINWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaagaaggttgggttcagaagaggggagaatatataaaa
aactggaggccacgatacttccttttgaagacagatggctcattcataggatataaagag
aaacctcaagatgtggatttaccttaccccctcaacaacttttcagtggcaaagtgccag
ttaatgaaaacagaacgaccaaagccaaacacatttattatcagatgtctccagtggacc
actgtcatagagagaacatttcatgtagatactccagaagaaagggaagaatggacagaa
gctatccaggctgtagcagacagactgcaaaggcaagaagaggagagaatgaattgtagt
ccaacttcacaaattgataatataggggaggaagagatggatgcttctacaactcatcat
aaaagaaagacaatgaatgattttgactatttgaaactactaggtaaaggcacttttggg
aaagtcattttggttcgagagaaggcaagtgggaaatattatgctatgaagattctgaag
aaagaagtcattattgcaaaggatgaagtggcacacactttaacggaaagcagagtatta
aagaacactagacatccctttttaacatccttgaaatattccttccagacaaaagaccgt
ttgtgttttgtgatggaatatgttaatggtggagagctgtttttccatttgtcgagagag
cgggtgttctctgaggaccgcacacgtttctatggtgcagaaattgtctctgccttggac
tatctacattccggcaagattgtgtaccgtgatctcaagttggagaatttgatgctggat
aaagatggccacataaaaattacagattttggactttgcaaagaagggatcacagatgca
gccaccatgaagacattttgtggcacaccagaatatctggcaccagaggtgttagaagac
aatgactatggccgagcagtagactggtggggtctcggggttgtcatgtatgaaatgatg
tgtgggaggttgccgttctacaaccaggaccatgagaaactttttgaactgatactaatg
gaagacattaaatttcctcgaacactctcttcagatgcaaaatcattgctttcagggctc
ttgataaaggatccaaataaacgccttggtggaggaccagacgatgcaaaagaaattatg
agacatagtttcttttctggaataaactggcaagatgtatatgataaaaagcttgtacct
ccttttaagcctcaagtaacatctgagacagataccagatactttgatgaagaatttaca
gctcagactattacaataacgccacctgagaaatatgatgaggatggtatggactgcatg
gacaatgagaggcggccgcatttccctcagttttcctactctgcaagtggacgggaataa

DBGET integrated database retrieval system