KEGG   Oryctolagus cuniculus (rabbit): 100342931
Entry
100342931         CDS       T03373                                 

Gene name
IFNB1
Definition
(RefSeq) interferon beta 1
  KO
K05415  interferon beta
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04217  Necroptosis
ocu04380  Osteoclast differentiation
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04668  TNF signaling pathway
ocu05135  Yersinia infection
ocu05142  Chagas disease
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100342931 (IFNB1)
   04668 TNF signaling pathway
    100342931 (IFNB1)
   04151 PI3K-Akt signaling pathway
    100342931 (IFNB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100342931 (IFNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100342931 (IFNB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100342931 (IFNB1)
   04621 NOD-like receptor signaling pathway
    100342931 (IFNB1)
   04622 RIG-I-like receptor signaling pathway
    100342931 (IFNB1)
   04623 Cytosolic DNA-sensing pathway
    100342931 (IFNB1)
   04650 Natural killer cell mediated cytotoxicity
    100342931 (IFNB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100342931 (IFNB1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100342931 (IFNB1)
   05152 Tuberculosis
    100342931 (IFNB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100342931 (IFNB1)
   05162 Measles
    100342931 (IFNB1)
   05164 Influenza A
    100342931 (IFNB1)
   05161 Hepatitis B
    100342931 (IFNB1)
   05160 Hepatitis C
    100342931 (IFNB1)
   05168 Herpes simplex virus 1 infection
    100342931 (IFNB1)
   05163 Human cytomegalovirus infection
    100342931 (IFNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100342931 (IFNB1)
   05169 Epstein-Barr virus infection
    100342931 (IFNB1)
   05165 Human papillomavirus infection
    100342931 (IFNB1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100342931 (IFNB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100342931 (IFNB1)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100342931 (IFNB1)
SSDB
Motif
Pfam: Interferon Forkhead
Other DBs
NCBI-GeneID: 100342931
NCBI-ProteinID: XP_002708014
Ensembl: ENSOCUG00000021649
UniProt: G1TTX4
LinkDB
Position
1
AA seq 180 aa
MINRCILQIALLLCFSTTALSMSYNSLQIQLWHGSLTCAKLLLQLNGTTEDCLNERINFK
VPKEIKEPQQLQKEDTTLVIFEMLNNIFDIFRKNFSSTGWNETLVENLLGETHLQIHHLK
SKINKKVTLESIRMNLRLKSYYWRIMDYLETKQYSNCAWKIVQLEIFRNFSFIIMLIDYL
NT seq 543 nt   +upstreamnt  +downstreamnt
atgatcaacaggtgtatccttcaaatcgctctcctgttgtgcttctccaccacagctcta
tccatgagctacaactcgcttcagatccaactatggcacggaagtctgacgtgtgcgaag
ctcctgctccagttgaatggaacgactgaggactgcctcaatgagaggataaacttcaaa
gtccccaaggagattaaggaaccacaacagctccagaaagaagacaccaccttggttatc
tttgaaatgctcaacaacatctttgacattttcagaaaaaatttctctagcactggctgg
aatgagacccttgttgagaaccttcttggtgaaacccatttgcagattcatcatctgaag
agcaaaataaacaaaaaggtaaccttggagagcatcagaatgaatctacgcctgaagagc
tattactggaggatcatggattatctggagaccaagcagtatagcaactgtgcctggaaa
atagtccagttggaaatcttcaggaacttttcctttatcatcatgctcatagattacctc
taa

DBGET integrated database retrieval system