KEGG   Oryctolagus cuniculus (rabbit): 100342948
Entry
100342948         CDS       T03373                                 

Gene name
TP53I3
Definition
(RefSeq) tumor protein p53 inducible protein 3
  KO
K10133  tumor protein p53-inducible protein 3 [EC:1.-.-.-]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100342948 (TP53I3)
Enzymes [BR:ocu01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     100342948 (TP53I3)
SSDB
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2 ADH_N ADH_N_2 HupF_HypC
Other DBs
NCBI-GeneID: 100342948
NCBI-ProteinID: XP_002710115
Ensembl: ENSOCUG00000011212
UniProt: G1T0V1
LinkDB
Position
2
AA seq 332 aa
MLAVHFDQPGGAENLYLKEVDKPSPGDGEVLLKVAASALNRADILQRQGGYPPPPGASSI
LGLEASGHVAELGPGCRGNWKIGDSAMALLSGGGQAQYVTVPEELLMPIPEGLTLLQAAA
IPEAWLTAFQLLHLVGNVQAGDTVLIHAGSSGVGTAAIQLAWMAGAIPLVTAGSQQKLQM
AEKLGAAAGFNYKEEDFSEAALKFTQGAGVNLILDCIGSPYWEKNVHCLAVDGRWILYGL
MGGANINGPLFSKLLSKRGSLIASLLRSRNKKYKQMLVRAFTEQALPHFSTEGPQRLLPV
LDRVYPVTEIQEAHKYMEANKNVGKIVLELPH
NT seq 999 nt   +upstreamnt  +downstreamnt
atgttggccgtgcactttgatcagcctggtggcgcagaaaacctctacctgaaggaagtg
gacaagccgagcccgggcgacggggaagtcctgctgaaggtggcggccagcgccctgaac
cgggccgacattctccagaggcaaggtggctatcccccacccccaggagccagcagcatt
ttgggactcgaggcatctggacatgtggcagagctggggcctggctgccgggggaattgg
aagatcggcgactcggctatggctctgctgtctggtgggggccaggctcagtatgtcact
gtcccggaagagctcctcatgcccatcccagaaggactgaccttgctgcaggctgcagcc
attcctgaggcctggctcaccgccttccagctgttacacctcgtggggaacgttcaggct
ggagacaccgtgctgatccatgcaggatcgagtggtgtgggcacagctgccatccaactt
gcctggatggcgggagccatccctctggtcacagctggctcccaacaaaagcttcagatg
gcagaaaagcttggagcagctgccggcttcaattacaaagaggaggatttttctgaagca
gccctgaaattcacccaaggtgctggagtaaaccttattctagactgcataggcagcccc
tactgggagaagaatgtccactgcctggctgttgatgggcgctggattctctatggcctg
atgggaggagccaacatcaacgggccgctgttttcaaagctactttctaaacgaggaagt
ctgattgctagtttgctgaggtccaggaacaaaaagtacaagcagatgctggtgagagct
ttcacggagcaagctctgccccacttctccacggagggcccccagcgtctactgccggtt
ctggacagagtctaccccgtgactgaaatccaggaggcccataagtacatggaagctaac
aagaacgtgggcaaaatcgtcctggagctgcctcactga

KEGG   Oryctolagus cuniculus (rabbit): 100351308
Entry
100351308         CDS       T03373                                 

Gene name
EI24
Definition
(RefSeq) EI24, autophagy associated transmembrane protein
  KO
K10134  etoposide-induced 2.4 mRNA
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100351308 (EI24)
SSDB
Motif
Pfam: EI24
Other DBs
NCBI-GeneID: 100351308
NCBI-ProteinID: XP_008257934
Ensembl: ENSOCUG00000014670
UniProt: G1T7V7
LinkDB
Position
1
AA seq 340 aa
MADSVKTFLQDLARGIKDSIWGICTISKLDARIQQKREEQRRRRASSVLAQRRAQSIERK
QESEPRIVSRIFQCCAWNGGVFWFSLLLFYRVFIPVLQSVTARIIGDPSLHGDVWSWLEF
FLTSIFSALWVLPLFVLSKVVNAIWFQDIADLAFEVSGRKPHPFPSVSKIIADMLFNLLL
QALFLIQGMFVSLFPIHLVGQLVSLLHMSLLYSLYCFEYRWFNKGIEMHQRLSNIERNWP
YYFGFGLPLAFLTAMQSSYIISGCLFSILFPLFIISANEAKTPGKAYLFQLRLFSLVVFL
SNRLFHKTVYLQSALSSSASAEKFPSPHASPAKLKATAGH
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggccgacagtgtcaaaacctttctccaggaccttgccaggggtatcaaagactccatc
tggggtatctgtaccatctccaagctagatgctcgaatccagcaaaagagagaagagcag
cgtcgaagaagggcaagcagtgtcctggcacagaggagagcccagagtatagaacggaag
caagagagtgagccacgtattgttagtagaattttccagtgttgtgcttggaatggcgga
gtgttctggttcagtctcctcttgttttatcgagtgtttattcctgtgcttcagtcagta
acagcccgcatcattggtgacccatccctgcatggagatgtttggtcatggctggaattc
ttcctcacatccattttcagtgctctttgggtgctccccctgtttgtgctcagcaaagtt
gtgaatgccatctggtttcaggatatagctgacctggcatttgaggtatcagggaggaag
cctcaccccttccctagtgtgagcaaaatcattgcggacatgctcttcaaccttttgctg
caggctcttttcctcatccaggggatgtttgtgagtctctttcccatccatcttgtcggt
cagctggttagtctcctgcatatgtcccttctctactccctgtactgctttgaatatcgt
tggttcaataaaggaattgaaatgcaccagcggttgtcgaatattgaaaggaactggcct
tactactttggatttggtttacccttggcttttctcacagcaatgcagtcttcgtacatt
atcagtggatgcctcttttccatcctgtttcctttattcattatcagtgctaatgaagca
aagacccctggaaaagcatatcttttccagttgcgcctgttctccttggtggtcttctta
agcaacagactcttccacaagacagtctacctgcagtctgccttgagcagctcagcctct
gcagagaagttcccttcaccacatgcatctcctgccaaactgaaggctactgcaggccac
tga

DBGET integrated database retrieval system