KEGG   Oryctolagus cuniculus (rabbit): 100342974
Entry
100342974         CDS       T03373                                 

Gene name
SRRM1
Definition
(RefSeq) serine and arginine repetitive matrix 1
  KO
K13171  serine/arginine repetitive matrix protein 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03013  RNA transport
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100342974 (SRRM1)
   03015 mRNA surveillance pathway
    100342974 (SRRM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100342974 (SRRM1)
   03041 Spliceosome [BR:ocu03041]
    100342974 (SRRM1)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     100342974 (SRRM1)
Spliceosome [BR:ocu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   SR-related proteins
    100342974 (SRRM1)
SSDB
Motif
Pfam: PWI ETRAMP
Other DBs
NCBI-GeneID: 100342974
NCBI-ProteinID: XP_002716019
Ensembl: ENSOCUG00000008438
UniProt: A0A5F9DTZ2
LinkDB
Position
13
AA seq 905 aa
MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL
GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP
SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREKRERSRSPRRRKSRSP
SPRRRSSPVRRERKRSHSRSPRHRTKSRSPSPAPEKKERTPELPEPSVKVKEPSVQEATS
TSDILKVPKPEPVPEPKEPSPEKNSKKEKEKTRARSRSRSKSRSRTRSRSPSHTRPRRRH
RSRSRSYSPRRRPSPRRRPSPRRRTPPRRMPPPPRHRRSRSPVRRRRRSSASLSGSSSSS
SSSRSRSPPKKPPKRTSSPPRKTRRLSPSASPPRRRHRPSPPATPPPKTRHSPTPQQSNR
TRKSRVSVSPGRTSGKVTKHKGTEKRESPSPAPKPRKVELSESEEDKGGKMAAADSVQQR
RQYRRQNQQSSSDSGSSSSSEDERPKRSHVKNGEVGRRRRHSPSRSASPSPRKRQKETSP
RGRRRRSPSPPPTRRRRSPSPAPPPRRRRSPTPPPRRRTPSPPPRRRSPSPRRYSPPIQR
RYTPSPPPKRRTASPPPPPKRRASPSPPPKRRVSHSPPPKPRSSPVTKRRSPSLSSKHRK
GSSPSRSAREARSPQPNKRHSPSPRPRVPQTSSSPPPARRAPSSSPQRRQSPSPSTRPIR
RVSRTPEPKKTKKTASPSPQSVRRVSSSRSVSGSPEPAAKKPPAPPSPVQSQSPSTNWSP
AVPVKKAKSPTPSPSPARNSDQEGGGKKKKKKKDKKHKKDKKHKKHKKHKKEKAVAAAAV
AAAAAVPPAAVTAATTTSAQEEAEAALEPKKETESEAEDNLDDLEKHLREKALRSMRKAQ
VSPQS
NT seq 2718 nt   +upstreamnt  +downstreamnt
atggacgcgggattcttccgcggaacaagtgcggaacaggataatcggttcagcaacaaa
cagaagaaactactgaagcagctgaagtttgcagaatgcctagaaaaaaaggtggacatg
agcaaagtaaatttggaagttataaagccttggataacaaaacgagtaacggaaatcctt
gggtttgaagatgatgttgtgattgagtttatattcaaccagctggaagtgaagaatcca
gactctaaaatgatgcaaatcaacctgactgggtttttgaatggaaaaaatgctagagaa
tttatgggagaactgtggcctctgctgttaagtgcacaagaaaacatcgctggaatcccc
tctgctttcctggaactgaagaaagaagaaataaaacagagacagattgagcaagaaaaa
ttggcatctatgaaaaagcaagatgaagacaaagataagagggataaggaagaaaaagaa
agcagcagagaaaaaagggaacggtctcgaagcccgagaagacgcaaatccagatctcct
tcccctagaagacggtcttcccctgtcaggagagagagaaagcgcagtcattctcgatct
ccccgccacagaaccaagagccggagtccttcccccgcgccagaaaagaaggaaagaact
cctgagctcccagaaccttcagtgaaggtcaaagaaccctcagtgcaggaggcgacttcg
actagtgacatcctgaaagttcccaagcctgaacctgtaccagaacctaaagaaccttct
ccagaaaaaaattccaaaaaggaaaaggagaagaccagagcacgatctcggtcacgttcc
aaatcaaggtcacggacgcggtctcgctctccttctcacactcgacctagacggcgccat
agatcccgatcaagatcatactctcctagaagacggccaagcccgaggaggcgcccatcc
cctcggagaagaactcctccaagacgaatgcctcctccgccacggcacaggaggagcaga
tctccagtgcgaagaagacgacgttcatcagcatccttgtctggaagtagctcatcatcc
tcttcatctcgttcccggtcgccgccaaagaaacctcctaagaggacatccagtccccct
cgaaaaactcgcaggctatctccttccgcgagtcctccaaggcgaaggcacaggccatcc
cctccagcaactccaccaccaaaaactcgccattccccaacaccccagcagtcaaaccgt
actagaaaaagccgtgtttctgtgtctccagggagaacttcaggtaaagtgacaaagcat
aaaggtactgagaaaagagaatccccttcaccagcaccgaaacctagaaaagtagaatta
tctgaatcagaagaagacaaaggtggcaaaatggctgcagcagattctgtgcagcagaga
cgccagtacagacgacagaaccagcagtcttcatctgactctggctcctcttcgtcctca
gaagatgagcgacccaaaagatcccacgtgaagaatggtgaggtaggcaggcggcggaga
cattccccttccaggagtgcctctccctcaccacgaaagcgccagaaagagacttcccct
cgtggtagacggaggagaagtccctcaccaccacccaccagaaggcggcgctctccttct
cccgctcctcctccgcgacggcgcaggtctcctacaccaccgccccgacgaaggactcct
tctccaccgccacgccggcgctcgccttcccctcggaggtactcccctcccatacagagg
agatacaccccttctccacctcccaagagaaggacggcttctcctcctccccctccaaaa
cggagggcgtcgccatctccaccaccaaagcggcgagtctcgcattctccacctcccaaa
ccgagaagctcgccggtcaccaagagacgctcgccttcgttgtcatccaagcataggaaa
ggctcttcgccaagccgctccgcccgggaagcccgctcgccacagccaaacaagcggcac
tcgccttcccctcggcctcgagttcctcagacctcctccagccctccacccgcgcggaga
gcaccgtcgtcctcaccccaaagaaggcagtctccatctccaagtactaggcccattagg
agagtctcccggactccggagcctaaaaagacaaaaaagactgcctctccaagcccacag
tctgtaaggagggtctcatcctcccgatctgtgtctggatctcctgagccagcagctaaa
aaacctccagcacctccgtcccctgtccagtctcagtcgccctctacaaactggtcacca
gcggtaccggtcaaaaaggctaagagcccaacaccaagcccgtcaccggcaaggaattca
gatcaagaaggaggtggaaagaaaaagaagaaaaagaaggacaagaaacacaaaaaggat
aagaagcacaagaagcacaaaaaacacaagaaggagaaggcggtggcagcggcggccgtc
gcggctgctgctgccgtcccccctgcagctgtcactgctgccacgaccacctcagcacag
gaggaggcagaggcagcgctggagcccaagaaggagactgaaagtgaagctgaagataac
cttgatgacctagagaagcacctgcgggagaaggccctgcggtccatgcggaaggctcag
gtgtccccacagtcctag

DBGET integrated database retrieval system