KEGG   Oryctolagus cuniculus (rabbit): 100342991
Entry
100342991         CDS       T03373                                 

Gene name
MSI2
Definition
(RefSeq) musashi RNA binding protein 2
  KO
K14411  RNA-binding protein Musashi
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100342991 (MSI2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100342991 (MSI2)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     100342991 (MSI2)
SSDB
Motif
Pfam: RRM_1 RRM_7 PHM7_cyt
Other DBs
NCBI-GeneID: 100342991
NCBI-ProteinID: XP_002719144
Ensembl: ENSOCUG00000010440
LinkDB
Position
19
AA seq 324 aa
MADLTSALTSVMFSPSSKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGF
GFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSANTVVE
DVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKK
AQPKEVMFPPGTRGRARGLPYTMDAFMLGMGMLGYPNFVATYGRGYPGFAPSYGYQFPGF
PAAAYGPVAAAAVAAARGSGSNPARPGGFPGANSPGPVADLYGPASQDSGVGNYISAASP
QPGSGFGHGIAGPLIATAFTNGYH
NT seq 975 nt   +upstreamnt  +downstreamnt
atggccgatctgacatcggcgctcacttctgttatgttttctccctctagtaaaatgttt
atcggcggactgagctggcagacctcaccagatagccttagagactattttagcaaattt
ggagaaattagagaatgtatggtcatgagagatcccactacgaaacgctccagaggcttc
ggcttcgtcacgttcgcggacccagccagcgtagataaagtgctaggtcagccccaccac
gagttagattccaagacgattgaccccaaagttgcatttcctcgtcgagcgcaacccaag
atggtcacaagaacaaagaagatatttgtaggcggattatctgcgaacactgttgtggaa
gatgtcaagcaatattttgagcagtttggaaaggtggaagatgcgatgctgatgtttgac
aaaactaccaacaggcacagagggttcggctttgtcacttttgagaatgaagacgttgtg
gagaaagtctgtgagattcatttccatgaaatcaataataaaatggtagaatgtaagaaa
gcacagcctaaggaagtcatgttcccacctgggacgagaggccgggcccggggactgcct
tacaccatggacgcgttcatgctgggcatgggaatgcttggctaccccaactttgtggca
acctatggccgcggctaccccggattcgctcctagctacggctatcagttcccaggcttc
ccggcggcggcctatggaccagtggcggcggcagcagtggcagcggcccgcggatcaggc
tccaacccggcgcggcccggaggcttcccgggggccaacagcccaggaccggtcgccgat
ctctacggccctgccagccaggactccggagtggggaattacataagcgcggccagccct
cagccgggctccggcttcggccacggcattgctggacctttgattgcaacggcctttaca
aatggataccattga

KEGG   Oryctolagus cuniculus (rabbit): 100352797
Entry
100352797         CDS       T03373                                 

Gene name
MSI1
Definition
(RefSeq) musashi RNA binding protein 1
  KO
K14411  RNA-binding protein Musashi
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100352797 (MSI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100352797 (MSI1)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     100352797 (MSI1)
SSDB
Motif
Pfam: RRM_1 RRM_7 Nup35_RRM_2 PHM7_cyt
Other DBs
NCBI-GeneID: 100352797
NCBI-ProteinID: XP_008270526
Ensembl: ENSOCUG00000027716
LinkDB
Position
21
AA seq 362 aa
METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRS
RGFGFVTFADQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSVNT
TVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVE
CKKAQPKEVMSPTGSARGRSRVMPYGMDAFMLGIGMLGYPGFQATTYASRSYTGLAPGYT
YQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMAAAAAAAAVVRGTGSHPWTMAPPPGST
PSRTGGFLGTTSPGPMAELYGAANQDSGVSSYISAASPAPSTGFGHSLGGPLIATAFTNG
YH
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggagactgacgcgccccagcccggcctcgcctccccggactcgccgcacgacccctgc
aagatgttcatcgggggactcagttggcagactacgcaggaagggctgcgtgaatacttc
ggccagttcggggaggtgaaggagtgtctggtgatgcgggaccccctgaccaagagatcc
aggggtttcggcttcgtcactttcgcggaccaggcgggggtggataaagtgctggcgcag
tcgcggcacgagctcgactccaaaacaattgaccccaaggtggcctttcctcggcgagca
cagcccaagatggtgactcgaacgaagaagatctttgtgggggggctgtcggtgaacacc
acggtggaggacgtgaagcagtacttcgagcagttcgggaaggtggacgatgccatgctg
atgtttgacaaaaccaccaaccggcaccgagggttcgggtttgtcacgtttgagagcgaa
gacatcgtggagaaagtgtgtgaaatccacttccatgaaatcaacaacaaaatggtggaa
tgtaagaaagctcagccaaaggaggtgatgtcgccgacgggctcagcccgggggaggtct
cgagtcatgccctatggaatggatgccttcatgctgggcatcggcatgctgggttaccca
gggttccaagccacgacctacgccagccggagctacacaggcctcgcccctggctacacc
taccagttccccgaattccgtgtagagcggacccctctcccgagcgccccagtcctcccc
gagctcacagccattcctctcactgcttacggacccatggcggcggcggcggcagcggcg
gctgtggttcgagggacaggctctcacccctggacgatggctccccctccaggttcgact
cccagccgcacagggggcttcctggggaccaccagccctggccccatggctgagctctac
ggggcggccaaccaggactcgggggtcagcagctacatcagcgccgccagccctgccccc
agcactggctttggccacagtcttgggggccccttgattgccacagccttcaccaatggg
taccactga

DBGET integrated database retrieval system