KEGG   Oryctolagus cuniculus (rabbit): 100343006
Entry
100343006         CDS       T03373                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04020  Calcium signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04144  Endocytosis
ocu04151  PI3K-Akt signaling pathway
ocu04510  Focal adhesion
ocu04540  Gap junction
ocu04630  JAK-STAT signaling pathway
ocu04810  Regulation of actin cytoskeleton
ocu05163  Human cytomegalovirus infection
ocu05200  Pathways in cancer
ocu05206  MicroRNAs in cancer
ocu05214  Glioma
ocu05215  Prostate cancer
ocu05218  Melanoma
ocu05230  Central carbon metabolism in cancer
ocu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100343006 (PDGFRA)
   04014 Ras signaling pathway
    100343006 (PDGFRA)
   04015 Rap1 signaling pathway
    100343006 (PDGFRA)
   04630 JAK-STAT signaling pathway
    100343006 (PDGFRA)
   04020 Calcium signaling pathway
    100343006 (PDGFRA)
   04072 Phospholipase D signaling pathway
    100343006 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    100343006 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100343006 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100343006 (PDGFRA)
   04540 Gap junction
    100343006 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100343006 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100343006 (PDGFRA)
   05206 MicroRNAs in cancer
    100343006 (PDGFRA)
   05230 Central carbon metabolism in cancer
    100343006 (PDGFRA)
   05231 Choline metabolism in cancer
    100343006 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    100343006 (PDGFRA)
   05218 Melanoma
    100343006 (PDGFRA)
   05215 Prostate cancer
    100343006 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100343006 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100343006 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100343006 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ocu04090]
    100343006 (PDGFRA)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100343006 (PDGFRA)
Protein kinases [BR:ocu01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100343006 (PDGFRA)
CD molecules [BR:ocu04090]
 Proteins
  100343006 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 Herpes_gE C2-set_2 Kinase-like DUF3912 IpaB_EvcA ECSCR
Other DBs
NCBI-GeneID: 100343006
NCBI-ProteinID: XP_017193297
Ensembl: ENSOCUG00000000258
LinkDB
Position
Un
AA seq 1093 aa
MGPSPPAFLVLVLGWLLAGPSLTRCQLPLPSISPGDSERVVPLNSSFTLRCSGESEVSWQ
YPVSEDEGPRVDVRSEENNTGYFVAVLEVGSATAAHTGLYTCYYNHTQTEDSDVEGSHVY
IYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLRNSQGLVPASYDSRHGF
NGTFTMGPYVCEATVRGKTVQTIPFNIYALKATSELDLEMEALQTVYKAGETIVVTCAVF
NNEVVDLQWTYPGEMKGKGVTMLEEIKVPTLKLVYTLTVPRATVKDSGDYECAARQATRE
VKEMKKVTIAVHEKGFVEIKPTFNQSEAVNLHEVKHFVVEVRAYPPPRISWLKDSRTLIE
NLTEITTDVEQVQETRYRCKLKLIRAKEEDSGHYTIVAENEDDVQSYTFELLTQVPASIL
DLVDDHHAPTGGQTVRCTAAGTPLPDVEWMICKDIKRCNNETSWTLLANNVSNIVTETHP
RGGGAVEGRVTFAKVEETLAVRCLARNPLGTENRELKLVAPTLRSELTVAAAVLVLLVVV
IVSLIILVVVWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRI
LGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIV
NLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLNPADESTR
SYVILSFENNGDYMDMKQADGTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSALESEV
KNLLSDDNAEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFG
LARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPG
MMVDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVESLLPGQY
KKSYEKIHLDFLRSDHPAVARMRVDTDSAYLGVTYKNEEDKLKDWEGGLDEQRLSADSGY
IIPLPDIDPVPEEDEEDGGKRNRHSSQTSEESAIETGSSSSTFMKREDETIEDMDMMDDI
GMDSSDLVEDSFL
NT seq 3282 nt   +upstreamnt  +downstreamnt
atgggaccctcccctccggccttcctggtcctggtcctcggctggctcctggcagggccg
agcctcacgcgctgccagctcccgctaccctccatctcccccggcgacagcgagagggtg
gtgccgctgaactcctctttcaccctgcgctgctccggggagagtgaagtgagctggcag
taccccgtgtccgaggacgagggccccagggtggacgtcaggagcgaggagaacaacact
ggctattttgtggccgtgctggaggtgggcagtgccaccgcggcccacacgggcttgtac
acctgctactacaaccacacgcagacggaggacagcgacgtggaaggcagccacgtgtac
atctacgtgccggacccggacgtcgccttcgtgcccctggggatgaccgactacctggtc
atcgtggaggacgacgactcggccatcatcccgtgtcgcaccaccgaccccgagaccccc
gtcaccctgcgcaacagccagggcctggtgcccgcctcctacgacagccggcacggcttc
aacggcaccttcaccatggggccctacgtgtgtgaggccaccgtgcgcgggaagaccgtg
cagaccatccccttcaacatctacgccttgaaagcgacgtcggagttggatctggaaatg
gaagcgctccagactgtgtataaggcaggagagacgattgtggtcacctgcgccgtcttc
aacaacgaagtggtggacctgcagtggacttaccccggggagatgaagggcaaaggtgtc
acaatgctggaagaaatcaaagtccccacactcaagctggtgtacacgctgacggtcccc
agggccacagtgaaggacagcggggactatgagtgcgctgcccgccaggccaccagggag
gtcaaagagatgaagaaggtcaccatcgctgtgcatgagaaggggtttgtggagatcaag
cccactttcaaccagtcggaggccgtcaacctgcacgaagtgaagcatttcgtggtggag
gtgcgcgcctaccccccgcccaggatatcctggctgaaggacagccggactctgatcgag
aatctcacggagatcaccacggacgtggagcaggtgcaggagacgcggtatcgatgcaag
ttgaagctcattcgggccaaggaggaggacagcggccattacaccatcgtggctgagaat
gaagatgacgtccagagctacacgttcgagctcttaactcaagtgcccgcatccatcctg
gacttggtggatgaccaccacgcccccaccgggggacagacggtgaggtgcacggctgcg
ggcacgcctcttccggatgtcgaatggatgatctgcaaggatatcaagaggtgtaacaat
gaaacctcgtggacgcttttggccaacaacgtgtccaacatcgtcacggagacccacccc
cggggcgggggcgccgtggagggccgggtgaccttcgccaaggtggaggagacccttgcc
gtccgctgcctggccaggaatcctctgggcacggagaaccgcgagctgaagctggtggct
cccaccctgcgctcggaactcacggtggcggccgcggtactggtgctgctggtggttgtg
attgtctcgctcatcatcctggttgtcgtctggaagcagaaacccaggtacgagattcgc
tggcgggtcatcgagtccatcagccccgacggccatgaatacatttacgtggaccccatg
cagctgccgtacgactcgcgatgggagtttccgcgagatggcctcgtgctgggtcgcatc
ttgggatccggggcctttgggaaagtggtggaagggacagcctacggactgagccggtcc
cagccggtcatgaaggtggcggtaaagatgctgaaacccacggccaggtccagcgagaag
caggctctcatgtccgagctgaagatcatgacccacctggggccgcatctcaacattgtc
aacttgctgggagcctgtaccaagtcaggccccatttacatcatcaccgagtactgcttc
tatggggatttggtcaactatctgcataagaacagggacagcttcctgagccgccacccg
gagaagcccaagaaggagctggacatctttgggttgaaccctgcagatgaaagcacacgg
agctacgtgattctgtctttcgagaacaatggtgactacatggacatgaagcaggccgac
ggcacgcagtacgtccccatgctggagcggaaagaggtgtccaagtactcggacatccag
cgctcgctgtacgatcgcccggcttcctacaagaagaagtccgcgctagagtccgaagtc
aaaaacctcctttcggatgacaacgcggaaggcctcaccttgttggatctgttgagcttt
acctaccaagtcgctcgagggatggaatttttggcttcaaaaaattgcgtccaccgggac
ctggccgcgcgcaacgtgctcctggcgcaagggaagattgtcaagatctgtgacttcggc
ctggccagagacatcatgcacgactccaactacgtctccaaaggcagcaccttcctgccc
gtgaagtggatggcccccgagagcatcttcgacaacctctacaccacgctgagcgacgtg
tggtcctacggcatcctgctctgggagatcttctctctcgggggcacaccctaccctggc
atgatggtggactccaccttctacaacaagatcaaaagcggctaccggatggccaagcct
gaccacgccaccagtgaagtctacgagatcatggtgaagtgctggaacagcgagcccgag
aagcggccctccttttaccacctgagcgagatcgtggagagtctgctgcccggacagtat
aaaaagagctatgagaagatccacctggacttcctgaggagcgaccaccccgccgtggcg
cgcatgcgtgtggacaccgacagcgcgtacctgggcgtcacctacaagaacgaggaggac
aagctgaaggactgggagggcggcctggacgagcagaggctgagtgccgacagcggctac
atcatccccctgcccgacatcgaccccgtgcccgaggaggacgaggaggacgggggcaag
cgcaaccggcacagctcgcagacctcggaggagagtgccatcgagacgggttccagcagc
tccaccttcatgaagagagaggacgagaccatcgaggacatggacatgatggacgacatt
ggcatggactcctcggacctggtggaggacagcttcctgtga

DBGET integrated database retrieval system