KEGG   Oryctolagus cuniculus (rabbit): 100343128
Entry
100343128         CDS       T03373                                 

Gene name
HCFC2
Definition
(RefSeq) host cell factor C2
  KO
K14966  host cell factor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100343128 (HCFC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100343128 (HCFC2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ocu03036]
    100343128 (HCFC2)
   03029 Mitochondrial biogenesis [BR:ocu03029]
    100343128 (HCFC2)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100343128 (HCFC2)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    NSL complex
     100343128 (HCFC2)
   HMT complexes
    COMPASS/SET1 complex
     100343128 (HCFC2)
    MLL-HCF complex
     100343128 (HCFC2)
Mitochondrial biogenesis [BR:ocu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100343128 (HCFC2)
SSDB
Motif
Pfam: Kelch_5 Kelch_3 Kelch_1 Kelch_4 Kelch_6 Kelch_2 fn3 Macoilin
Other DBs
NCBI-GeneID: 100343128
NCBI-ProteinID: XP_002711279
Ensembl: ENSOCUG00000013543
UniProt: A0A5F9CG93
LinkDB
Position
4
AA seq 790 aa
MAAPSLLNWRRVSSFTGPVPRARHGHRAVAIRELMIIFGGGNEGIADELHVYNTVTNQWF
LPAVRGDIPPGCAAHGFVCDGTRILVFGGMVEYGRYSNELYELQASRWLWKKVKPHPPSS
GLPPCPRLGHSFSLYGNKCYLFGGLANESEDSNNNVPRYLNDFYELELQHGSGVVGWSIP
VTKGVVPSPRESHTAVIYCKKDSGSPKMYVFGGMCGARLDDLWQLDLETMSWSKPETKGT
VPLPRSLHTASVIGNKMYVFGGWVPHKGENIETSSHDCEWRCTSSFSYLNLDTAEWTTLV
SDSQEDKKNSRPRPRAGHCAVAIGTRLYFWSGRDGYKKALNSQVCCKDLWYLDTEKPPAP
SQVQLIKATTNSFHVKWDEVPTVEGYLLQLNTDLPYQAPSLDSSAALNMPGVRMDPYRQG
TNNIIPNSISDTVNSAKTEHTGMKGTLMKNTPDFKASTDSNAILHSSLASNASNHNSVED
MLRKNEGPHTSAHIGVLSCLDLRTVVSETSVSSTVSSTQTMVTQQTIKTESSSTNGAVVK
DETSLTTFSTKSEVDETCALPASKISRVETHGAAMPFSKEIPSNPVATVKAGERQWCDVG
IFKNNTALVNQFYLLPKGKQSISKVGNADVPDYSLLKKQDLVPGTGYRFRVAAINGCGIG
PFSKISEFKTCIPGFPGAPSAVRISKNAEGIHLSWEPPTSPSGNILEYSAYLAIRTAQIQ
DNPSQLVFMRIYCGLKTSCIVTTGQLANAHIDYTSRPAIVFRISAKNEKGYGPATQVRWL
QGNNKKAPLN
NT seq 2373 nt   +upstreamnt  +downstreamnt
atggcggctcccagcctcctcaactggaggcgggtttcctccttcacggggccggtcccc
cgcgcccgacacggacaccgggccgtggccatacgggagctgatgatcatctttggagga
ggcaacgagggcatcgcggacgagctgcacgtctacaacaccgttacgaatcagtggttc
ctaccagctgttagaggagacatccctccaggctgcgctgcacatggatttgtctgtgat
ggcaccagaatattagtgtttgggggaatggttgaatatggaagatacagcaatgagctg
tatgagttacaagcaagtcgttggttatggaaaaaagtgaagccccatcccccttcttct
gggttacctccttgtcctaggcttggacatagcttctctttatatggtaacaaatgctat
ttgtttggtggcctggcaaatgaaagtgaagattcaaacaataatgttcctaggtattta
aatgatttctatgagttggagctacagcatggttctggtgttgtgggttggagcattcca
gtgactaaaggggttgtgccttcaccaagagaatctcacacagctgttatatattgcaaa
aaagattctgggagtcctaaaatgtatgtttttggtggaatgtgtggtgctcgtctggat
gacctgtggcaacttgacttagaaactatgtcttggtcaaaaccagaaactaaagggaca
gtgccacttccacgaagccttcacacagccagcgttataggaaataagatgtacgttttt
ggtggatgggttccacataagggggaaaatattgagacttcatctcatgattgtgaatgg
agatgtaccagttctttttcttatctaaatctggatacggcagagtggacaacccttgta
tcagattctcaggaagataaaaaaaattcacgaccaagaccaagagctggacactgcgct
gttgcaattggcactcggttatatttttggagtggaagagatggttacaaaaaagcactg
aatagtcaagtttgctgcaaagatctttggtatcttgatactgaaaaaccaccggcacca
tcacaagtacaattgatcaaagccactaccaactcatttcatgtcaagtgggatgaagtg
cctacggttgaggggtatcttttgcagttaaacacagacttgccataccaagctccatcg
ttagattcttcagctgcactgaatatgccaggagtcaggatggacccctacagacaaggc
actaataacatcattccgaacagtatcagtgatacagtaaacagtgcaaaaactgaacat
acaggcatgaaaggaactttaatgaaaaacacaccagacttcaaagcatcaacagattct
aatgctattttacattcatctttggcatctaatgcttctaatcataatagtgtggaagac
atgctaaggaaaaatgaaggtcctcacacgtcagcacacataggtgtacttagttgcctg
gacttaagaacagtagtctctgaaacttctgtatccagtactgtttccagcacacaaacc
atggtaacccagcagaccattaaaactgaatcctccagtacaaatggggcagtggttaaa
gatgaaacttcactaacaacattcagtaccaaatctgaagttgatgaaacatgtgctctg
cctgcaagtaagatcagccgtgtagagacacatggtgcagcaatgccattctctaaagag
attccttcaaatccagtggccacagtgaaagcaggagaacgacagtggtgtgatgtggga
atttttaaaaataatacagctttggtgaaccagttttatttgctgccaaaaggaaagcaa
agcatctcaaaggtaggaaacgcagatgtacctgactacagtctactcaagaaacaggat
cttgttccaggcacaggatacagattcagggttgctgcaatcaatggttgtggaataggc
cctttcagcaaaattagtgaatttaaaacttgtattcctggttttcctggagctccttct
gcagttagaatttcaaagaatgctgaaggtatccatctttcctgggaacctccaacttca
ccttctggaaatattctggaatattcagcctacttggctattcgcacagcacagatacaa
gataatccaagccaacttgtgtttatgaggatttattgtggtcttaaaacatcatgtata
gtaactactgggcaacttgcaaatgcacatattgattatacgtccaggcctgccattgtg
ttcaggatatcagcaaagaatgaaaagggatatggaccagctacacaagtccgatggctt
caaggtaacaataagaaagcacctttaaattga

DBGET integrated database retrieval system