KEGG   Oryctolagus cuniculus (rabbit): 100343242
Entry
100343242         CDS       T03373                                 

Gene name
ABCC2, EBCR, MRP2
Definition
(RefSeq) ATP binding cassette subfamily C member 2
  KO
K05666  ATP-binding cassette, subfamily C (CFTR/MRP), member 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01523  Antifolate resistance
ocu01524  Platinum drug resistance
ocu02010  ABC transporters
ocu04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    100343242 (ABCC2)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    100343242 (ABCC2)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100343242 (ABCC2)
   01523 Antifolate resistance
    100343242 (ABCC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ocu02000]
    100343242 (ABCC2)
Transporters [BR:ocu02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC1, 2, 3, 4, 5, 6, 10, 11, 12, 13 subgroups
    100343242 (ABCC2)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N MMR_HSR1 AAA_16 RsgA_GTPase Dynamin_N AAA_29 P-loop_TraG MeaB DUF87 FKBP_N_2
Other DBs
NCBI-GeneID: 100343242
NCBI-ProteinID: XP_008268548
Ensembl: ENSOCUG00000008164
UniProt: G1SUM7
LinkDB
Position
18
AA seq 1543 aa
MLDKFCNSTFWNSSLLDSPEADLPLCFEQTVLVWIPLIFLWLLAPWQLFHVYRSRTKRSP
ITKFYLAKQVLVGCLLILAVIELILVLTENSGQATIPAVRYTNPILYLVTWLLVLLIQHS
RQSCVQKNSWFLSLFWILSILCGTFQFQTLIRTLLRDSNSNLAYSCLFFISYGFQILILI
LSAFSEKDNSSKNPSVTASFLSKISFSWYDSVVLKGYKRPLTLEDVWDIDEEFKAKTIVS
RFEVHMAKELKKARKAFQKRQQKKSQKNSRLQGLNKNQSQSQDVLVLEETKKKNKKSGTT
KDFPKSWLVKTIFKTFYMVLLKSFLLKLVYDLLTFLNPQLLKLLITFVSDPNSYAWLGYI
FAILLFAVALIQSICLQTYFHMCFNLGMCVRTTVMATVYKKALTISNLAKRQYTIGETVN
LMSVDAQKLMDVTNFIHLVWSSVLQIVLSIYFLWVELGPSVLAGVGVMVLLIPVNGILAT
KNRNIQFKNMKYKDKRLRIMNEILSGMKILKYFAWEPSFKDQVHNLRKKELKNLRTFAYM
QSVVMFLLYLTPVLVSVTTFSVYVLVDSNNILDAEKAFTSITLFNILRFPMSMLPNVISA
MLQASVSVDRLEKYLSGDDLDTSAIQRDPNFDKAVQFSEASFTWDRNLEPTIRNVNLDIM
PGQLVAVVGTVGSGKSSLMSAMLGEMENVHGHITIKGTTAYVPQQSWIQNGTIKDNILFG
AEFDERRYQRVLEACALLPDLEILPGGDLAEIGEKGINLSGGQKQRISLARASYQNSDIY
ILDDPLSAVDAHVGKHIFNKVLGPNGLLNGKTRLLVTHSLHFLPQVDEIVVVENGTILEK
GSYSSLLAKKGVFAKNLKMFVKHTDSEGEVTVNDGSEEDDDDDSGLISSIEEFPEDSISL
TLKRENSLHRTLSRSSRSSGRRLKSLKNSLKAQNGKTPKEEEVVKGQKLIKKEFMETGKV
KFSIYLKYLQAIGWCSIVGIIFAYVLNSVAFIGSNLWLSAWTSDSNTYNGTNYPASQRDL
RIGIFGVLGLAQGLTVLVASFWSASGCAHASNILHKQLLNNILRAPMSFFDTTPIGRIVN
RFAGDISTVDDTLPQSLRSWMMCFLAIISTLIMICMATPVFAVIIIPLAIIYVAVQVFYV
ATSRQLRRLDSVTRSPIYSHFTETVSGLPVIRAFEHQQRFLKQNEIGIDTNQKCVSSWIT
SNRWLAFRLELVGNLVVFSSALMMVIYRDTLSGDVVGFVLSNALNITQTLNWLVRMTSET
ETNIVAVERITEYIKVENEAPWVTDKRPPAGWPHKGEIQFSNYQVRYRPELDLVLKGINC
DIKSMEKIGVVGRTGAGKSSLTNCLFRILEAAGGHITIDGIDIASIGLHDLRGKLTIIPQ
DPVLFSGSLRMNLDPFNNYSDEEIWRALELAHLKSFVAGLQHGLSHEVSEAGDNLSIGQR
QLLCLGRALLRKSKILVLDEATAAVDLETDHLIQTTIRNEFSHCTVITIAHRLHTIMDSD
KIMVLDNGNIVEYGSPEELLESAGPFSLMAKESGIENVNNTAF
NT seq 4632 nt   +upstreamnt  +downstreamnt
atgctggataagttctgcaactctactttttggaattcctcactcctggacagcccagag
gcagacctgccactctgttttgaacaaactgttctggtgtggattccgttgatcttcctt
tggctcctagctccttggcagcttttccatgtgtacagatccaggaccaagagatcacct
ataaccaaattctaccttgctaagcaggtgcttgttgggtgtcttcttattctagctgtc
atagagctgatcctcgtactcacagaaaactctggacaagccacaatccccgctgttaga
tacaccaatccaatcctctacctagtcacatggctcctggttctgctgatccaacacagc
aggcagtcatgtgtacagaagaactcttggttcctgtccctgttctggattctctcaata
ctctgtggcactttccagtttcagactctgatcaggacactcctgcgggatagcaattct
aatctggcctactcctgcctgttcttcatctcctatggatttcagatcctgatcctgatc
ctttcagcattttcagaaaaagataattcatcaaaaaatccatcagtcacagcttcattt
ctgagtaaaatttcttttagttggtatgacagtgtcgttctgaaaggttacaagcgacct
ctgacacttgaagatgtctgggacattgatgaagagtttaaagccaaaacaatagtgagc
aggtttgaagtgcacatggcaaaagagctgaagaaagccaggaaggcatttcagaaacgg
cagcagaagaaatcccagaagaactccaggctgcagggcttgaacaagaaccaaagtcaa
agccaagatgttcttgttctggaagaaactaaaaagaaaaacaagaagtctgggaccaca
aaagactttcccaagtcctggttggtcaagaccatcttcaagaccttctacatggtgctc
ctaaaatcattcctactgaagctagtgtatgatctcctcacatttctgaatcctcaactg
ctgaagttgctgatcacctttgtaagcgaccccaactcgtatgcgtggctcggatacatc
ttcgctatcctcttgtttgctgtggctctcatccagtcgatttgccttcagacttatttt
catatgtgtttcaatctgggcatgtgtgtacggacaacggtcatggctacagtgtataag
aaggccctgaccatatccaacttggccaagaggcagtacaccattggagaaaccgtgaac
ctgatgtctgtggatgctcagaagctcatggatgtgaccaacttcattcacttagtgtgg
tccagtgttctgcagatcgtcttatccatctacttcctgtgggtagagttgggaccctca
gtcttagcaggtgttggagtgatggtgcttctcatcccagttaatgggatactggccacc
aagaacaggaatattcagttcaaaaatatgaagtataaagacaaacgtttaaggatcatg
aatgagattctcagtggaatgaagatcctgaaatattttgcctgggagccttcattcaaa
gaccaagtccacaaccttcggaagaaagaactcaagaacctgcggacttttgcttacatg
caatctgtggtcatgttcctcttgtatttaactccagtgctggtgtctgtgaccacattt
tctgtttatgtcctggtggacagcaacaatattttggatgcagaaaaggccttcacctcc
atcaccctcttcaatattctgcgctttcccatgagcatgcttcccaatgtgatctccgcc
atgctccaggccagtgtttccgtggatcggctagagaagtacttgagcggggatgacttg
gacacatctgcaattcaacgtgaccccaattttgacaaagctgtgcagttttctgaggcc
tcctttacctgggaccggaatttggaacccacaatccgaaatgtgaacctggacattatg
ccaggccaattggtggctgtggtagggactgtgggttctgggaaatcctctttaatgtca
gcgatgctgggagaaatggaaaatgtccacgggcacatcaccatcaagggcaccactgca
tatgtcccacagcagtcctggattcagaatggcaccataaaggacaacatcctgtttgga
gcagagtttgatgaaagaaggtaccagcgagttctggaggcatgtgcactcctcccagac
ttggaaatattgcctggaggagacctggccgagattggagagaagggtataaatctcagt
ggtggtcagaagcagcgcatcagcctggccagagcttcctatcaaaactcagacatctat
attctagatgaccccttgtcagccgtggatgctcatgtgggaaaacatattttcaataag
gtcttgggacccaatggcctattgaatggcaagactcgactgttggtgacacatagcctt
cactttcttccccaagtggatgagattgtggttgtggaaaatggcaccatcttggagaaa
ggatcctacagctccctgctggccaagaagggagtatttgctaagaatctgaagatgttt
gtaaagcatacggattctgaaggggaggtcacagtcaatgacggcagtgaagaagatgat
gacgatgactctgggctgatatctagtatagaggaattccctgaagattcgatttccttg
accttgaagagggagaacagccttcatcgaacgcttagccgcagctctaggtccagtggc
agacgtctgaaatccctgaaaaactccttgaaagcacagaatgggaaaaccccaaaggag
gaagaagtggtgaaaggacaaaaactaattaagaaggagttcatggaaactggaaaggtg
aaattctccatctacttgaaatacctacaagcaataggatggtgttctatagtaggcatc
atctttgcctatgttttgaattctgtggcttttattggctccaacctttggctcagtgct
tggaccagtgattctaacacctacaatggcaccaactatccagcctctcagagagacttg
agaattgggatcttcggagttctgggtttagcacaagggctaactgtgcttgtagcaagt
ttctggagtgccagtggttgtgcccatgcatcaaatatcttgcataagcaactgctgaac
aatatccttcgagcacccatgagtttttttgacacaacacccataggccggattgtgaac
aggtttgctggtgacatttccacagtggatgacaccctccctcagtccttgcgtagctgg
atgatgtgcttcctggcaataatcagcaccctcatcatgatctgcatggccacccctgtc
ttcgccgtcatcatcattcctctcgccattatttatgtggctgttcaggtgttttatgtg
gctacctcccgccagctgagacgtctggactctgtcacccgatccccaatctactctcac
tttactgagactgtgtcaggtttgcctgtgatccgtgcctttgagcaccaacagcgattt
ctgaaacaaaatgagatagggattgacaccaaccagaaatgtgtgtcttcctggattact
tccaacaggtggcttgcatttcgcctggagctggttgggaacttggtcgtgttcagttca
gccttgatgatggttatttatagagataccctcagtggggacgttgtgggctttgttttg
tccaatgcactcaatatcacacaaaccctgaactggctagtgaggatgacatccgaaacg
gagaccaacatcgtggctgttgagcgaattaccgagtacataaaagtggaaaatgaggcc
ccctgggtgacggataagaggcctccagcaggttggccccacaaaggcgagatccagttc
agcaactaccaagtgcggtaccggcctgagctggatctggtgctgaaagggatcaattgt
gacatcaagagcatggagaagattggtgtggtgggcaggacaggggccgggaagtcgtcc
ctcaccaactgcctcttcagaatcttagaggctgcgggcggccacatcaccattgatgga
atagatatcgcttccatcgggctccacgaccttcgaggcaagctgaccatcatccctcag
gaccctgtcctgttctcgggaagcctgcggatgaacctagaccctttcaacaactactca
gatgaggagatctggagggccctggagctggctcacctcaagtcctttgtggctggcctc
caacatggactgtcccacgaagtgtcagaggccggggacaacctgagcatcgggcagcgg
cagctgctgtgcctgggcagggctctgcttcggaaatccaagatcctggtcctggatgaa
gccactgccgcggtggacctggagacggatcacctcattcagaccaccatccgcaacgag
ttctcccactgcacggtcatcaccatcgctcacaggctgcacaccatcatggacagcgac
aagataatggtcctggacaatgggaacatcgtcgagtacggcagccctgaagaactgctg
gagagcgctggccccttctctctgatggccaaggagtctggcattgagaatgtgaacaac
acagcgttctag

DBGET integrated database retrieval system