KEGG   Oryctolagus cuniculus (rabbit): 100343248
Entry
100343248         CDS       T03373                                 

Gene name
ATP7A
Definition
(RefSeq) ATPase copper transporting alpha
  KO
K17686  P-type Cu+ transporter [EC:7.2.2.8]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    100343248 (ATP7A)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100343248 (ATP7A)
Enzymes [BR:ocu01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.8  P-type Cu+ transporter
     100343248 (ATP7A)
SSDB
Motif
Pfam: HMA Hydrolase E1-E2_ATPase Hydrolase_3 3A Hydrolase_6 HAD_2
Other DBs
NCBI-GeneID: 100343248
NCBI-ProteinID: XP_002720177
Ensembl: ENSOCUG00000014160
UniProt: G1T6U3
LinkDB
Position
X
AA seq 1499 aa
MDSNMNVHSITISVEGMTCNSCVRTIEQQIEKVNGVHHIKVSLEEKNATIIYDPELQTPK
TLQEAINDMGFDAILHNANPLLVSTDTVFLTVTSSLAPPWDHIQSILLKTKGVTDIKISP
QQRTAVVTIIPSIVNANQIVEQVPDLSLDTGALDRKSGSEDHSMAQAGEVMMKMKVEGMT
CHSCTSTIEGKIGKLQGVQRIKVSLDNQEATIVYQPHLITAEEIKKQIEAAGFPAFIKKQ
PKYLKLGAIDVERLKNTPVKSPEGSQQRTLSHTSDSTTTFLIDGMHCKSCVSNIESALST
LQYVSNIVVSLENRSAIVKYNASLVTPETLRKAIEAVSPGQYRVSIASEVESSPNSPSSS
SLQKIPLNVVSQPLTQETVINIDGMTCNSCVQSIEGVISKKPGVKSIRVSLANNSGTIEY
DPLLTSPETLREAIEDMGFDATLSDMNEPLVVIAQPSSDMPLLTSTNEFYPKMMTPIHDK
EEAKTSSKCYIQVTGMTCASCVANIERNLRREEGIYSVLVALMAGKAEIRYNPTVIQPPM
IAEFIRDLGFGATVIESASEGDGVLELVVRGMTCASCVHKIESTLTKHRGIFYCSVALAT
NKAHIKYDPEIIGPRDIIHTIESLGFEASLVKKDRSSSHLDHKREIRQWRRSFLVSLFFC
IPVMGLMIYMMIMDHHLATLHHHQNISNEEMINIHSSMFLERQIMPGLSIMNLLSFLLCV
PVQFFGGWYFYIQAYKALKHKTANMDVLIVLATTIAFSYSLVILLVAMYERAKVNPITFF
DTPPMLFVFIALGRWLEHIAKGKTSEALAKLISLQATEATVVTLGSDNILLSEEQVDVEL
VQRGDIIKVVPGGKFPVDGRVIEGHSMVDESLITGEAMPVAKKPGSTVIAGSINQNGSLL
IRATHVGADTTLSQIVKLVEEAQTSKAPIQQFADKLSGYFVPFIVFVSIATLVVWIIIGF
LNFEIVETYFPGYNRSISRTETIIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQ
NGILIKGGEPLEMAHKVKVVVFDKTGTITHGTPVVNQVKVLVESNKISRNKILAIVGTAE
SNSEHPLGAAITKYCKQELDTETLGTCIDFQVVPGCGISCKVTNIEGLLRKNNWKIEENN
IKNASLVQIDASNEQSSTSSSMIIEVQNSNALNSQQYKVLIGNREWMIRNGLVIGNDVDA
SMTEHERKGRTAVLVAVDDELCSLIAIADTVKPEAELAVHILKSMGLEVVLMTGDNSKTA
RSIASQVGITKVFAEVLPSHKVAKVKQLQEEGKRVAMVGDGINDSPALAMANVGIAIGTG
TDVAIEAADVVLIRNDLLDVVASIDLSRKTVKRIRINFVFALIYNLVGIPIAAGVFMPVG
LVLQPWMGSAAMAASSVSVVLSSLFLKLYRKPTYENYELHAQSQIGQKSPSEISVHVGID
DTSRNSPKLGLLDRIVNYSRASINSLLSDKRSLNSVVTSEPDKHSLLVGDFREDDDTTL
NT seq 4500 nt   +upstreamnt  +downstreamnt
atggattcaaacatgaatgtgcattctattaccatctctgtggaggggatgacatgcaat
tcctgtgttcggaccattgagcagcagattgaaaaagtgaatggtgtacatcacattaaa
gtttcactggaagaaaaaaatgcaactattatttatgaccctgaactacaaactccaaag
actttacaggaagctatcaatgacatgggctttgatgctattctccataatgctaaccct
ctccttgtttcaactgatactgtgtttctgactgttacttcttccctggctccaccgtgg
gaccatatccagagcatattgctcaagacaaagggcgtgacagacattaaaatttcccct
cagcaaagaactgcagtagtgacaataatcccttctatagtgaatgccaatcagatagta
gaacaggttccagatctcagtttagatactggggctctggacagaaagtcaggaagtgaa
gatcacagtatggctcaagcaggtgaagtcatgatgaagatgaaagtggaggggatgaca
tgccattcgtgtaccagcaccattgaaggaaaaattgggaaactgcaaggtgttcaacga
attaaagtctccctggacaaccaagaagctactattgtttatcaacctcatcttatcaca
gcagaggaaataaaaaaacagattgaagctgcgggcttcccagcattcatcaaaaaacag
cctaagtacctcaaattgggagctattgatgtagagcgtctgaagaacacaccagtcaaa
tccccagaaggatcacagcaaaggactctgtcgcataccagtgattcaacaaccactttc
ctcatagatggcatgcattgtaaatcatgtgtgtcaaatattgaaagtgctttatctaca
ctccaatacgtaagcaacatagtagtttctttagagaatagatctgccattgtaaagtac
aatgcaagcttagtcactccagaaactctgaggaaagcaatagaagctgtatcaccaggg
caatatagagttagtattgcaagtgaagttgagagttcccccaactctccctccagctca
tctcttcagaagattcctttgaatgtagttagccaacctctgactcaggaaaccgtgata
aacattgatggcatgacttgtaattcctgtgtgcaatctattgaaggtgtcatatcaaaa
aagccaggtgttaaatccatacgagtttcccttgcaaataacagtgggactattgagtat
gatcctctactaacctctccagaaaccttgagagaagcaatagaagacatggggtttgat
gctaccttgtcagatatgaatgaaccactggtagtaatagctcagccctcatcagacatg
ccacttttgacttcaaccaatgaattttaccctaaaatgatgacaccaattcatgacaag
gaggaggcaaagacttcatctaagtgttacatacaggtcactggcatgacttgtgcttcc
tgtgtagcaaacattgaaaggaatttaagacgggaagaaggaatttattctgtacttgtg
gctctgatggctggcaaggcagaaataaggtataatcctactgttatacaacctccaatg
atagcagagttcatccgagaccttggctttggagctacagtaatagaaagtgccagtgaa
ggggatggtgttctggaacttgttgtgagaggaatgacgtgtgcctcctgtgtacataaa
atagaatctactctcacaaaacacagagggatcttctactgctctgtggccctggcaacc
aacaaagcacacattaaatatgatccagagattattggtcccagagatattatccataca
attgaaagcttaggttttgaagcttctttggtcaagaaggatcggtcatcaagccaccta
gaccataaacgagaaataagacaatggagacggtccttccttgtgagcctgtttttctgt
attcctgtaatggggctaatgatatatatgatgattatggaccaccaccttgcaactctg
caccatcatcagaacataagtaacgaagaaatgatcaacattcattcttctatgttcttg
gagcgccagatcatgccaggattgtctattatgaatttgctgtcctttttattgtgtgta
cctgtacagttttttggaggctggtacttttacattcaggcttacaaagcactgaagcat
aagacagcaaatatggacgtactgattgtgctcgcaaccaccattgcattttcttactcc
ttggttattcttctggtggcaatgtatgagagagctaaagtgaaccccattactttcttt
gacacacctcctatgttatttgtgttcattgcactaggccgatggctggaacatatagca
aagggaaaaacatcagaagctcttgcaaagctaatttcactacaggctacagaggcgact
gttgtaactcttggctctgataatattctcctgagtgaagaacaagtggacgtggaacta
gtacaacgtggagacatcattaaagtagttccaggaggcaaatttccagtggatggccgt
gttattgaaggacattccatggtggatgagtccctcatcacaggggaggcaatgcctgtg
gctaagaaacctggcagcacagtgattgctggttccattaatcagaatgggtcacttctt
atccgggcaacccatgttggagcagacacaaccctttctcaaattgtgaaacttgtggag
gaggcacagacatcaaaggctcctattcagcagtttgcagacaaactcagtggctacttt
gttccttttattgtttttgtttccattgctaccctggtggtatggattataattggattt
ttgaattttgaaattgtggaaacctactttcctggctacaatagaagtatctcccgaaca
gaaacgataatacgctttgctttccaagcctctatcacagttctgtgtattgcatgtcct
tgttcactgggactggccactccaactgctgtgatggtgggcacaggagtaggtgctcaa
aatggcatactaatcaaaggtggagagccactggagatggctcataaggtaaaggtagtg
gtatttgataagactggaaccattactcatggaaccccagtagtaaatcaagtcaaggtt
ctagtggaaagtaacaaaatatcccgtaataagattctggccattgtggggactgctgaa
agtaacagtgaacaccctctaggagcagctataaccaaatactgcaagcaggagctggac
actgaaaccttgggtacttgcatagatttccaagttgtgccaggctgtggtattagctgt
aaagtaaccaatattgaaggtttgctacgtaagaataactggaagatagaggaaaataat
attaaaaatgcatccctggttcaaattgatgcaagtaatgaacagtcatcaacttcatct
tccatgattattgaggtccagaactcaaatgctcttaattctcagcagtacaaagtcctc
attggtaaccgggagtggatgattagaaatggccttgtcattggtaatgacgtagatgct
tccatgactgagcatgaaagaaaaggccggactgctgtattggtggcagttgatgatgaa
ctgtgcagcttgatagccattgctgacacagtgaagcctgaggcagaattggctgtccat
attctgaaatccatgggcttagaggtagttctgatgactggagacaacagtaaaacagcc
agatcgattgcatctcaggttggcattacaaaggtgtttgctgaagttctaccttctcac
aaggttgctaaggtgaagcaacttcaggaggaggggaaacgggtagcaatggtaggagat
ggaatcaatgactccccggctctggccatggctaatgttggaattgccataggcacaggt
acagatgtagccattgaagcagctgatgtggttttgataaggaatgatcttctggatgta
gtggcgagcattgacttgtcaaggaagacagtcaagaggattcggataaattttgtcttt
gctctaatttataatctggtcggaattcccatagctgctggagtttttatgcccgttggt
ttggttttacagccctggatggggtctgcagcaatggctgcttcatctgtttccgtggta
ctttcttctctcttccttaaactttacaggaaaccaacctatgagaattatgagctgcat
gcccagagccagataggacagaagagtccttcagagatcagcgtgcacgtcggaatagat
gacacctcaagaaattctcctaaactgggtttgctggaccggattgttaattacagcaga
gcttccataaactcactactgtctgataagcgctccttaaacagtgttgttaccagtgag
cctgacaagcactcactccttgtgggagacttcagggaggatgacgacaccacactgtaa

KEGG   Oryctolagus cuniculus (rabbit): 100344865
Entry
100344865         CDS       T03373                                 

Gene name
ATP7B
Definition
(RefSeq) ATPase copper transporting beta
  KO
K17686  P-type Cu+ transporter [EC:7.2.2.8]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    100344865 (ATP7B)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100344865 (ATP7B)
Enzymes [BR:ocu01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.8  P-type Cu+ transporter
     100344865 (ATP7B)
SSDB
Motif
Pfam: HMA Hydrolase E1-E2_ATPase Hydrolase_3 Hydrolase_6 HAD HAD_2 Claudin_2
Other DBs
NCBI-GeneID: 100344865
NCBI-ProteinID: XP_008272090
Ensembl: ENSOCUG00000004145
LinkDB
Position
Un
AA seq 1468 aa
MNHLVESGTSIPIQTAPNDAILSKLSLPARAWEAAMKQSFAFDNVGYEGGLDSMCPSPTT
TGIVSILGMTCQSCVKSIEDRISSLKGIVSIKISLEQASATVKYVPSVMSLQQVCHHIGD
MGYEASVTEGKAASWPSRSLPAQEAVIKLRVEGMTCQSCVSSIEGKIGKLQGVVRVRVSL
GNQEAVITYQPYLIQPEDLRDHVNDMGFEATIKNKMAPLSLGPIDIERLQNTNLKRPSVS
TNQNLNNSETSAHPGSQVATLQLRVDGMHCKSCVLNIEGNIGQLPGVQNIQVFLENRTAQ
VQYDPSHVTPESLQKAIEALPPGNFKVSLPDGAEERGTENRSSNGHSPVSPQRGQVQSTC
STLVLTIVGMTCASCVQSIEGVISQREGVQRISVSLAEGTGTVLYDPSVISPEELRAAVE
DMGFEASVIPENGSTNHTGNHGAENSMAWIKSGAPVSVPDMVPHTGELPKNHHPGRSSKS
PQSTGMVVPQKCFLQIRGMTCASCVSNIERNLQKEDGILSVLVALMAGKAEIKYNPEVIQ
PPEIAQLIQDLGFEATVMEDATGSDGDIELIITGMTCASCVHNIESNLTRTNGITYASVA
LATSKAHVKFDPEIIGPRDIVKIIEEIGFHASLAQRNPNAHHLDHKVEIKQWKKSFLCSL
VFGIPVMGLMIYMLIPSNQPHESMILDHNIIPGLSILNLIFFILCTFVQFLGGWYFYVQA
YKSLRHRSANMDVLIVLATSIAYVYSLIILVVAVAEQAERSPVTFFDTPPMLFVFISLGR
WLEHVAKSKTSEALAKLMSLQATEATVVTLGEDNLIIREEQVPMELVQRGDIIKVVPGGK
FPVDGKVLEGNTMADESLITGEAMPVTKKPGSIVIAGSINAHGSVLITATHVGNDTTLAQ
IVRLVEEAQMSKAPIQQLADRFSGYFVPFIIIISTLTLVVWIIIGFIDFGVVQKYFPNPN
KHISQTEIILRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQHGVLIKGGKPLEMA
HKIKTVMFDKTGTITHGVPKVLRVLLLVDMATLPLRKVLAMVGTAEASSEHPLGIAVTKY
CKEELGTETLGYCTDFQAVPGCGIGCKVSSVEGLLAHSERLLSEQSGHVNRLGSLPAEKD
AASQTFCVLIGNREWMRRNGLTISSDINDAMTDHEMKGQTAILVAIDGVLCGMIAIADSV
KPEAALAVHTLKSMGVDVVLITGDNRKTARAIATQVGINKVFAEVLPSHKVAKVQELQNE
GKKVAMVGDGVNDSPALAQADVGIAIGTGTDVAIEAADVVLIRNDLLDVVASIHLSKRTV
RRIRVNLVLALIYNLVGIPIAAGVFMPIGIVLQPWMGSAAMAASSVSVVLSSLQLKCYKK
PDVERYEAQAHGRMKPLTASQVSVHVGMDDRRRGDSPRATSWDQVSYVSQVSLSSLTSDR
LSRHSPAVDDAGDKWSLLLNDRDEEQYI
NT seq 4407 nt   +upstreamnt  +downstreamnt
atgaaccatcttgttgaaagtggaacctccattcctattcagactgccccaaatgatgct
attttatctaaactgtctttgcctgctcgtgcctgggaagcagcgatgaaacagagtttt
gcctttgacaatgttggctatgaaggtggtctggatagcatgtgcccttctccgacgacc
actggcatagtcagtatattgggcatgacttgccagtcgtgtgtgaagtccattgaagac
aggatttccagtttgaaaggcattgtgagcattaagatttccctggaacaagcaagtgca
actgtgaaatatgtgccatcagtcatgagcttgcaacaggtttgtcatcacatcggggac
atgggctatgaggccagcgtcacagaaggaaaggctgcctcctggccgtccagatccttg
ccggcccaggaggctgtgatcaagctgcgggtggagggcatgacctgccagtcctgcgtc
agctccattgaaggcaagattgggaaactgcaaggtgtggtaagagtcagagtctcactt
ggcaaccaggaggcagtcatcacttatcagccttaccttattcaacctgaagacctcagg
gaccatgtaaatgacatggggtttgaagctaccatcaagaacaaaatggctcccttaagc
ttgggaccaattgatattgagcggttacaaaacactaacctaaagagaccttcagtttct
actaaccagaatttgaataattctgagacctcggcgcacccaggaagccaagtggccacc
ctgcaactgagagtagatgggatgcactgtaaatcttgtgtcttgaatattgaaggaaat
ataggccaactcccaggggttcaaaatattcaagtgttcctggagaacagaactgcgcaa
gtacagtatgacccttctcatgtcaccccagagtctctgcagaaggccattgaagcactt
ccacctgggaacttcaaagtttctcttccagatggagcggaagagagagggacagagaac
aggtcttccaatggtcattctcctgtctccccccagagaggccaggtacagagtacatgc
agtactttagtgctcaccattgttggcatgacctgtgcgtcctgtgtccagtccatcgaa
ggcgtgatctcccaacgggaaggggtgcagcgaatatcagtctctttggctgaagggact
ggaacagttctttatgatccctctgtaataagcccagaagagctgagagctgctgtggaa
gacatgggatttgaggcttcagtcattcctgaaaatggttcaaccaaccatactggaaac
catggtgctgagaattccatggcgtggattaaaagtggtgcacccgtgtcagtgccagat
atggttccccacactggggagctgcctaaaaaccaccaccctggccgctcatcaaagtcc
ccgcaatccacaggaatggtagtaccacagaagtgctttttacagatcagaggcatgacg
tgtgcatcctgtgtgtctaacatcgaaagaaatcttcagaaagaagatggtattctctct
gtgctggttgccttgatggcaggaaaggctgagatcaagtataacccggaggtcatccag
ccgcccgagatagctcagctcatccaggacctaggctttgaggccacagtcatggaggac
gccacaggctcagacggcgacatcgagttgattatcacagggatgacctgtgcttcctgt
gttcacaacatagagtctaatctcacaaggacgaatggcatcacctacgcctctgtggcc
ctcgccaccagcaaagcgcacgtgaagtttgatcctgaaattattggtcctcgggatatt
gtgaaaattattgaggaaattggctttcatgcttccttggcccagagaaaccccaatgct
caccacttggaccacaaggtggaaataaagcagtggaagaagtctttcctgtgcagcctg
gtgtttggcatccctgttatgggattaatgatctatatgttaatacccagcaatcagccc
cacgagtctatgatcctggaccacaacatcatcccaggactgtccattctgaatctcatc
ttctttatcttgtgtacatttgtccagttcctcggtgggtggtatttctatgttcaggcc
tataagtctctgagacacaggtcggccaacatggacgtgctcattgtactggccaccagc
atcgcctatgtctactccctcatcatcctggtggttgcagttgcggagcaggctgagagg
agccctgtgacattcttcgacacgccgcccatgctgtttgtgttcatttccctggggcgg
tggctggaacacgtggcaaagagcaaaacctcagaagcccttgccaaactcatgtctctc
caagccacagaggccaccgttgtgacccttggtgaggacaacttaatcatcagagaggag
caagtacccatggagctggtgcagcggggtgatatcatcaaggttgtccccgggggaaag
ttccctgtggatgggaaagtgctggaaggcaataccatggctgacgagtccctcatcaca
ggagaagccatgcccgtcactaagaaacctggaagcatcgtgattgctgggtctataaac
gcacatggctctgttctcattacagccacccatgtgggcaacgatactactttagctcag
attgtgagattggtagaagaggctcagatgtcaaaggcacccattcagcaactggctgac
cggttcagtgggtattttgtcccatttatcatcatcatttcaactttgacgttggtggta
tggatcataatcggttttatcgattttggtgttgttcagaaatactttcctaaccccaac
aagcatatctcccagacagagatcatcctccggtttgcgttccagacgtccatcacagtg
ctgtgcattgcctgcccctgttccctggggctggccacacccacggcagtcatggtgggc
actggggtggctgcccagcatggcgtgctcatcaagggaggcaagcctctggagatggcc
cacaagataaagactgtgatgtttgacaaaactggcaccattacccatggggtccccaaa
gtcctgcgggtcctgctgcttgttgacatggccacactacccctcaggaaggttctggcc
atggtggggactgcggaggccagcagcgagcacccgttaggtatagcagtcaccaaatac
tgtaaagaggagcttggaacagagaccttgggatactgcacagacttccaggccgtgcca
ggctgtggaatcggctgcaaagttagcagtgtggaaggccttctggcccacagcgagcgc
ttgcttagtgaacagtctggacacgtgaacaggctgggctcccttcctgcggaaaaagat
gctgcctcccagactttctgtgtgctgattggaaaccgcgagtggatgaggcgcaatggc
ttaaccatttccagtgacatcaatgatgccatgacagaccatgagatgaagggacagaca
gccatcctggtggctattgatggtgtgctgtgcggcatgatcgccatcgcagactctgtc
aagcccgaggccgccctggccgtgcacacactgaaaagcatgggcgtggatgtggttctg
atcacgggagacaaccggaagacagccagagccattgccacgcaggttggcatcaacaag
gtctttgcggaggtgctgccttctcacaaggtggccaaggtccaggagctccagaacgag
gggaagaaggttgccatggtgggagacggggtcaacgactccccggccttggcccaggcc
gatgtgggcattgccatcgggaccggcaccgatgtcgccatcgaggctgccgacgtcgtc
ctcatcagaaatgacttgctggacgtggtggccagcattcacctttccaagaggactgtc
cggaggatacgagtcaatctggtcctggcactgatctacaacctggtcgggatacccatt
gcggcaggtgtcttcatgcccatcggcatcgtgctgcagccgtggatgggctcagcagcc
atggcagcctcgtccgtgtctgtggtgctgtcttctctgcagctcaagtgctacaagaag
cccgacgtggagaggtacgaggcccaggcccatgggcgcatgaagcccctgactgcgtcc
caagtcagtgtgcacgtcggcatggatgaccggcgacgcggcgactcccccagggccaca
tcgtgggaccaggtcagctacgtcagccaggtgtctctgtcctccttgacatctgacagg
ctgtctcggcacagccctgcagtggacgatgctggggacaagtggtctctgctcctgaat
gacagggacgaggagcagtacatctga

DBGET integrated database retrieval system