KEGG   Oryctolagus cuniculus (rabbit): 100343573
Entry
100343573         CDS       T03373                                 

Gene name
FOXO3
Definition
(RefSeq) forkhead box O3
  KO
K09408  forkhead box protein O3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu04062  Chemokine signaling pathway
ocu04068  FoxO signaling pathway
ocu04137  Mitophagy - animal
ocu04151  PI3K-Akt signaling pathway
ocu04152  AMPK signaling pathway
ocu04211  Longevity regulating pathway
ocu04213  Longevity regulating pathway - multiple species
ocu04218  Cellular senescence
ocu04722  Neurotrophin signaling pathway
ocu04917  Prolactin signaling pathway
ocu05213  Endometrial cancer
ocu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100343573 (FOXO3)
   04151 PI3K-Akt signaling pathway
    100343573 (FOXO3)
   04152 AMPK signaling pathway
    100343573 (FOXO3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100343573 (FOXO3)
  09143 Cell growth and death
   04218 Cellular senescence
    100343573 (FOXO3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100343573 (FOXO3)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100343573 (FOXO3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100343573 (FOXO3)
  09149 Aging
   04211 Longevity regulating pathway
    100343573 (FOXO3)
   04213 Longevity regulating pathway - multiple species
    100343573 (FOXO3)
 09160 Human Diseases
  09162 Cancer: specific types
   05213 Endometrial cancer
    100343573 (FOXO3)
   05223 Non-small cell lung cancer
    100343573 (FOXO3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100343573 (FOXO3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100343573 (FOXO3)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    100343573 (FOXO3)
SSDB
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Other DBs
NCBI-GeneID: 100343573
NCBI-ProteinID: XP_008261561
UniProt: G1SZC6
LinkDB
Position
12
AA seq 675 aa
MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPVKPSGETAADSMIPEE
DDDEDDEDGGGRAGSAMAIGGGGGGGSGALGSGLLLEDSARLLAAGGQDLGPGPAPAAGA
LSGGTQTPLQPQQPLPPLQPGAAGGSGQPRKCSSRRNAWGNLSYADLITHAIQSSPDKRL
TLSQIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINP
DGGKSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTAPEAADDSPSQLAKWPGSPTSR
SSDELDAWTDFRSRTNSNASTVSGRLSPILASTELNEVQDDDAPLSPMLYSSSASLSPSA
SKPCAVELPRLTDMAGTMNLNDGLADNLMDDLLDNIPLPSSQPSPPGTLMQRSSSFPYAA
KGSGLGSPTGSFNSTVFGPSSLNSLRQSPMQTIQENKPATFSSMSHYGSQTLQDLLTSDS
LSHSDVMMTQSDPLMSQASTAVSAQNSRRHVMLRNDPMMSFAAQPNQGSLVNQNLLHHQH
QTQGALGGSRALSNSVSSMGLSDSSSLGSAKHQQPSPVSQSMQTLSDSLSGSSLYSASAN
LPVMGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGS
FTGAKQASSQSWVPG
NT seq 2028 nt   +upstreamnt  +downstreamnt
atggcagaggcgccggcctccccggccccgctctctccgctcgaagtggagctggacccg
gagttcgagccccagagccgaccgcgttcctgcacttggcccctgcagaggccggagctc
caggcgagcccggtcaagccctcgggggagacggccgccgactccatgatccccgaggag
gacgacgatgaagacgacgaggacggcggcggccgggctggctcggccatggcgatcggc
ggcggcggcggcggcgggagcggcgcgctgggctccgggctgctcctggaggattcggcc
cgcctgctggctgccggagggcaggacctcgggcccgggccagcgcccgcggcgggcgcg
ctgagcggggggacgcagactccgctgcagcctcagcagccgctgccaccgctgcagccg
ggggcggctgggggctcagggcagccgaggaaatgctcctcgcgccggaacgcctggggg
aacctgtcctacgccgacctgatcactcatgccatccagagctccccggacaagcggctc
actctgtcccagatctatgagtggatggtgcgctgtgtgccctacttcaaggataagggc
gacagcaacagctccgccggttggaagaactccatccgacacaacctgtcgctgcacagt
cggttcatgcgggtgcagaacgaggggacgggcaagagctcatggtggatcatcaacccc
gatgggggcaagagcgggaaggcgccccggcggcgggccgtttccatggacaacagcaac
aagtacaccaagagccgtggccgcgccgccaagaagaaggcggccctgcagacggcaccc
gaggcggccgacgacagcccctcccaactggccaagtggcccggcagccccacgtcgcgc
agcagcgacgagctggacgcctggacggacttccgctcgcgcaccaactccaacgccagc
acggttagcggccgcctgtcgcccatcctggcgagcacagagcttaatgaggtccaggac
gacgatgctccgctctccccgatgctgtacagcagctccgccagcctgtcgccttctgcg
agcaagccgtgcgccgtggagctgccgcggctcaccgacatggcgggcaccatgaacctg
aacgacgggctggctgacaacctcatggacgacctgctggacaacatccccctgccgtcc
tcccagccgtcaccccccgggacgctcatgcagcggagctccagcttcccctacgccgcc
aagggctccggcctgggctctccgaccggctcctttaacagcacggtgttcgggccgtcg
tctctgaactccctgcgccagtcccccatgcagaccatccaggagaacaagccagccact
ttctcttccatgtcgcactacggcagccagacactccaagacctgctcacttcagactcg
ctcagccacagcgacgtcatgatgacccagtcggaccccttgatgtctcaggccagcacc
gctgtgtctgcccagaactcccgccggcacgtgatgctgcgcaatgacccgatgatgtcc
tttgctgcccagcctaaccaggggagtttggtcaatcagaacttgctccaccaccagcac
cagacccagggcgctctcggtggcagccgtgccttgtcgaattccgtcagcagcatgggc
ttgagtgactccagcagcctcgggtcagccaaacaccagcagccgtctcccgtcagccag
tctatgcaaaccctctcggactcgctctcaggctcctccttgtactcagctagtgcaaac
cttcccgtcatgggccacgagaagttccccagcgacttggacctggacatgttcaatggg
agcttggaatgtgacatggagtccattatccgtagtgaactcatggacgcggacgggttg
gattttaactttgactccctcatctccacacagaacgttgttggtttgaacgtggggagc
ttcactggtgctaagcaggcctcatctcagagctgggtgccgggctga

DBGET integrated database retrieval system