KEGG   Oryctolagus cuniculus (rabbit): 100343636
Entry
100343636         CDS       T03373                                 

Gene name
DPY30
Definition
(RefSeq) dpy-30, histone methyltransferase complex regulatory subunit
  KO
K14965  protein dpy-30
Organism
ocu  Oryctolagus cuniculus (rabbit)
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ocu03036]
    100343636 (DPY30)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Histone modification proteins
   HMT complexes
    COMPASS/SET1 complex
     100343636 (DPY30)
    MLL-HCF complex
     100343636 (DPY30)
    MLL3/MLL4 complex
     100343636 (DPY30)
SSDB
Motif
Pfam: Dpy-30 RIIa
Other DBs
NCBI-GeneID: 100343636
NCBI-ProteinID: XP_002709976
Ensembl: ENSOCUG00000017877
UniProt: G1TEM5
LinkDB
Position
2
AA seq 99 aa
MEPEQMLEGQTQVAENPHSEYGLTDNVERIVENEKINAEKSSKQKVDLQSLPTRAYLDQT
VVPILLQGLAVLAKERPPNPIEFLASYLLKNKAQFEDRN
NT seq 300 nt   +upstreamnt  +downstreamnt
atggagccagagcagatgctggagggacagacgcaggttgcagagaaccctcattctgag
tatggtctcacagacaacgtagagaggatagtagaaaatgagaagattaatgcagaaaag
tcttcaaaacagaaggtggatctgcagtctttgccaacccgtgcctacctggatcagaca
gttgtgcctatcttattacagggacttgctgtgcttgcaaaggaaagaccaccaaatccc
attgaatttctagcatcttatcttttaaaaaacaaggcacaatttgaagatcgaaactga

DBGET integrated database retrieval system