KEGG   Oryctolagus cuniculus (rabbit): 100343674
Entry
100343674         CDS       T03373                                 

Gene name
AIFM2
Definition
(RefSeq) apoptosis inducing factor, mitochondria associated 2
  KO
K22745  apoptosis-inducing factor 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100343674 (AIFM2)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 DAO GIDA NAD_binding_8 Thi4 K_oxygenase HI0933_like Trp_halogenase Lycopene_cycl AlaDh_PNT_C FAD_binding_2 FAD_oxidored FAD_binding_3
Other DBs
NCBI-GeneID: 100343674
NCBI-ProteinID: XP_002718485
Ensembl: ENSOCUG00000004543
UniProt: G1SM02
LinkDB
Position
18
AA seq 373 aa
MGSQVSVDTGALHVVIVGGGFGGIAAASQLQALNVPFLLVDMKDSFHHNVAALRASVESG
FAKKTFISYSVTFKDNFRQGRVVGIDLKNQTVLLQGGEALPYSHLILATGSSGPFPGKLN
EVSCQQAAIQAYEDMVQQVQRSEFVVVVGGGSAGVEMAAEIKTEYPNKEVTLIHSQVTLA
DKELLPSVRQEVKEILLRKGVRLLLGERVSNLEELPLNEYRDYIKVQTDQGTEVATNLVI
LCNGIKVNSSAYHSALESRLAGNGALRVNEHLQVEGCSHVYAIGDCADVKEPKMAYHAGL
HAGVAVANIINSTRQRPLKVYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLAKSRDLF
VSTSWKTMKQSPP
NT seq 1122 nt   +upstreamnt  +downstreamnt
atggggtcccaggtctcagtggacacgggagccctgcacgtggtgatcgtgggcgggggc
ttcggtggtatcgcggccgcgagccagctgcaggcgctgaacgtgcccttcctgctggtg
gacatgaaggactccttccaccacaacgtggccgccctgcgtgcctccgtggagagtggg
ttcgccaaaaagacattcatttcctactcagtgaccttcaaggacaacttccggcagggt
cgggtggtcgggatagacctgaagaatcagacggtgctgctgcagggtggcgaggccctg
ccctactcgcatctaatcctggccacaggcagcagcgggcccttcccaggcaagttgaat
gaggtttcctgccagcaggccgccatccaagcctacgaggacatggtgcagcaggtccag
cgctcagagttcgtcgtggtggtgggaggaggctcggctggcgtggagatggccgcagag
attaaaaccgagtatcccaacaaagaggttacgctcattcactcccaagtgaccctggcc
gacaaggagcttctgccctccgtgcggcaggaggtgaaggagatcctgctgcggaagggc
gtgcggctgctgctgggtgagcgggtgagcaacctggaggagctgcctctgaacgagtat
cgggactacatcaaggtgcagacagaccagggcacggaggtggccaccaacctggtgatt
ctctgcaacggcatcaaggtcaacagctctgcctaccacagtgccttggagagcagactg
gccggcaacggtgctctgagagtgaacgagcacctccaggtggagggctgcagccacgtc
tacgccatcggcgactgtgccgacgtgaaggagcccaagatggcctatcacgccggcctc
cacgccggcgtcgctgtggccaacatcatcaactccacgaggcagaggcccctcaaggtc
tacaagccaggggcgctgaccttcctcctgtccatggggagaaatgacggcgtgggccag
atcagtggcttctacgtgggccggctcatggtccggctcgctaagagccgggacctgttc
gtgtccacgagctggaaaaccatgaagcagtccccaccctga

DBGET integrated database retrieval system