KEGG   Oryctolagus cuniculus (rabbit): 100343775
Entry
100343775         CDS       T03373                                 

Gene name
DAPK1
Definition
(RefSeq) death associated protein kinase 1
  KO
K08803  death-associated protein kinase [EC:2.7.11.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04140  Autophagy - animal
ocu05200  Pathways in cancer
ocu05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100343775 (DAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100343775 (DAPK1)
  09162 Cancer: specific types
   05219 Bladder cancer
    100343775 (DAPK1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100343775 (DAPK1)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: CAMK group
  DAPK family
   100343775 (DAPK1)
SSDB
Motif
Pfam: Pkinase Ank_2 Ank_5 Ank_4 PK_Tyr_Ser-Thr Ank_3 Ank Death COR Kdo RIO1 O_Spanin_T7 AAA_23 Choline_kinase ABC_tran APH
Other DBs
NCBI-GeneID: 100343775
NCBI-ProteinID: XP_017197667
Ensembl: ENSOCUG00000003518
UniProt: G1SJW2
LinkDB
Position
1
AA seq 1457 aa
MTVFRQENVDDFYDTGEELGSGQFAVVKKCREKSTGLQFAAKFIKKRRTKSSRRGVSRED
IEREVSILTEIQHPNVITLHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFL
KQILNGVYYLHSLQIAHFDLKPENIMLLDRNVPKPRIKIIDFGLAHKIDFGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFEEEY
FSNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSRKASAVNMEKFKKFA
ARKKWKQSVRLISLCQRLSRSFLSRSNMSVARSDDTLDEEDSFVMKAIIHAINDDNVPGL
QHLLGSLSNYDVNQPNKHGTPPLLIAAGCGNIQILQLLVKRGSRIDVQDKGGSNAVYWAS
RHGHVDTLKFLHENKCPLDVKDKSGETALHVAARYGHADVVQLLCSFGSNPDFQDKEEET
PLHCAAWHGYHAVARALCEAGCDVNIKNREGETPLLTASARGYHDIVECLAEHGADLNAS
DKDGHIALHLAVRRCQMEVIKTLISQGCLVDFQDRHGNTPLHVACKDGNLPIVVALCEAN
CHLDISNKYGRTPLHLAANNGILDVVRYLCLMGANVEALSSDAKTAEDLARSEQHAHVAG
LLARLRKDTHRGLFIQQLRPTQNLQPRIKLKLFGHSGAGKTTLVESLKCGLLRSFFRRRR
PRLSSTNSVRFPPSPLATKPAVSVSINNLYPGCENVSVRSRSMMFEPGLTKGMLEVFVAP
SHHLHCSADDQSTKAIDVQNAYLNGVGDFSVWEFSGNPVYFCCYDYFAANDATAIHIVVF
SLEEPYEIQLNQVIFWLSFLKSLVPVEEPIAFGGKLKNPLRVILVATHADIMNIPRPAGG
EFGYDKDTSLLKEVKNRFGNDLHISNKLFVLDAGASGSKDIKVLRSHLQEIRSQIISGCP
PMTHLCEKIISTLPSWRKLNGPNQLMSLQQFVYDVQDQLNPLASEEDLRRIAQQLHSIGE
INIMQSETVQDVLILDPRWLCTNVLGKLLSVETPRALHHYRGRYTVEDIQRLVPDSDVEE
LLQILDAMDICARDLSSGTMVDVPALIKTDNLQRSWTDEEDEVMVYGGVRVVPVEHLTPF
PCGIFHKVQVNLCRWIHQQSTEGDADIRLWVSGCKVTHRGAELLVLLVNHGQGIEVQVRG
LETEKIKCCLLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLRERHEPVMVYQPRDFFRA
QTLKETSLTNTMGGYKESFSSITCFGCHDVYAQASLGMDIHASDLSLLTRRKLSRLLDPP
DPMGKDWCLLAMNLGLPDLVAKYNTNSGAPRDFVPSPVHALLREWTSCPESTVGILMAKL
RELGRRDAADFLLKASSVFRINLDGAGPEAYASSCNSGTSYNSISSVVSRRDSHAWNPAV
GFINRQYVSAFCRRGCV
NT seq 4374 nt   +upstreamnt  +downstreamnt
atgaccgtgttcaggcaggagaacgtggatgatttctacgacaccggcgaggaacttggc
agcggacagtttgccgtggtgaagaaatgccgcgagaagagcaccggcctgcagtttgcc
gccaagttcatcaagaagcggaggaccaagtccagccggcgcggcgtgagccgcgaggac
atcgagagggaggtcagcatcctgacggagatccagcaccccaatgtcatcaccctgcac
gaggtgtacgagaacaagacggacgtcattctcatcctggagcttgttgcaggtggcgag
ctgtttgacttcctagctgaaaaggaatcgttgacagaagaggaagccacggaatttctc
aaacagatcctcaatggtgtttactacctgcactccctccagatcgcccactttgatctt
aagcctgagaacataatgcttttggacagaaatgtccccaagccccggatcaagatcatt
gactttgggctggcccataaaattgactttggcaatgagttcaagaacatattcgggacc
ccagagtttgtcgctcctgagatagtcaactacgagcccctgggactcgaggcggacatg
tggagtatcggggtaataacctatattcttctcagtggggcctccccgtttcttggagac
acgaagcaggagacgttagccaacgtgtctgctgtcaactacgaatttgaggaggagtat
ttcagcaacaccagtgcccttgccaaagatttcataagaagacttctggtcaaggatcca
aagaagagaatgaccattcaagatagcctgcagcatccttggatcaagcctaaagacacg
cagcaagcactcagtagaaaagcatcggccgtcaacatggagaagttcaagaagtttgca
gctcgcaagaagtggaagcaatccgttcgcctgatatcactgtgccaaagattatccagg
tctttcctgtccagaagtaacatgagcgtcgccagaagcgatgacactctggatgaggaa
gactcctttgtgatgaaggccatcatccacgccatcaatgacgacaacgtcccaggcctg
cagcacctgctgggctcattgtccaactacgatgtcaaccagcccaacaagcacgggaca
cctccgttactcattgctgccggctgtgggaatattcagattctgcagttgctcgtgaaa
agaggctcgagaatcgatgtgcaggataagggtggatccaacgcggtctactgggcctct
cggcatggccacgtagacaccttgaaatttctccatgagaacaagtgcccactggatgtg
aaagacaagtcgggagagacagcgcttcatgtggcagctcgctacggccacgccgatgtg
gttcagctactgtgcagctttggctccaaccccgacttccaggacaaggaggaggaaacc
ccactgcactgcgctgcctggcacggctaccacgccgtggccagggccctctgtgaagct
ggctgtgacgtgaacatcaagaaccgggaaggcgagacgcccctcctgacagcctcggcc
aggggctaccatgacatcgtggagtgtctggctgaacacggagccgacctcaatgcctcc
gacaaggatggacacatcgcacttcacctggccgtcaggcgctgtcagatggaggtcatc
aagaccctcatcagccagggctgccttgtggacttccaagacaggcatggcaacacccct
ctgcacgtggcctgcaaagacggcaacctgcctatcgtggtggccctctgcgaagcaaac
tgccacttggacatctcaaacaagtatggacgaacgcccctgcacctggcagccaacaac
gggatcctggatgtggtccggtacctctgtctgatgggtgccaacgtggaggcgctgagc
tcggacgcgaagaccgccgaagatctggcacgatcggaacagcacgcgcacgtggcaggt
ctcctcgccaggctccgaaaggacacgcaccgagggctcttcatccagcagctgcggccc
acgcagaacctgcagcccaggatcaagctcaagctgttcggccactccggggctgggaag
accacgctcgtggagtctctcaagtgcgggctgctccggagctttttcaggaggcgccgg
cccaggctgtcctccaccaactccgtccgcttcccgccctcgcccctggccaccaagcca
gcagtctccgtgagcatcaacaacctgtacccgggctgcgagaacgtgagcgtgaggagc
cgcagcatgatgttcgagccgggcctcaccaagggcatgctggaggtgttcgtggccccg
tcccaccacctgcactgctcggccgacgaccagtccaccaaggccatcgacgtccagaac
gcctatctgaacggcgtgggcgacttcagcgtgtgggagttctctggaaatcccgtgtac
ttctgttgctacgactactttgccgccaacgacgccacggccatccacatcgtagtgttc
agcctggaagagccctacgagatccagctgaaccaagtgattttctggctcagtttcctg
aagtcgctggtcccagtcgaggagcccatagcctttggcggcaagctgaagaacccgctg
cgggtgatcctggtggctacacacgctgacatcatgaacatccctcggccagcaggaggc
gagtttggatacgacaaagacacgtcattgctgaaagaggtcaaaaacaggttcgggaac
gacctccacatatccaataaactctttgttctggatgctggcgcttctggctccaaggac
atcaaggtgcttcggagtcacctgcaggagattcggagccagatcatctcgggctgcccg
cccatgacccacctgtgtgagaagatcatctccacgctgccctcctggaggaagctcaac
gggcccaaccagctgatgtcactgcagcagtttgtgtacgacgtgcaggaccagctgaac
ccgctggccagcgaggaggacctcaggcggattgcccagcagctgcacagcataggcgag
atcaacatcatgcagagtgaaacagtccaggatgtactcatcctggacccccgctggctc
tgcaccaacgtgctggggaagctgctgtccgtggagaccccccgggccctgcaccattac
cgcggccgctacaccgtggaggacatccagcgcctggtgcccgacagcgacgtggaggag
ctgctgcagatcctggatgccatggacatctgcgcccgggacctgagcagcggcaccatg
gtggatgtccccgctctgatcaagacggacaacctgcagcgctcctggacggacgaggag
gacgaggtgatggtgtacggaggcgtgcgcgtggtccccgtggagcacctcacccccttc
ccgtgcggcatcttccacaaggtgcaggtgaacctgtgccggtggatccaccagcagagc
accgagggagacgccgacatccgcctgtgggtgagcggctgcaaggtcacccaccgcggg
gccgagctgctcgtactactggtcaaccacggccagggcattgaggtgcaggtgcgcggg
ctggagacggagaagatcaagtgctgcctgctgctggactcggtgtgcagcaccatcgag
aacgtcatggccaccacattgccggggctgctgacggtgaagcactacctgagcccccag
cagctgcgggagcgccatgagcccgtcatggtctaccagccccgggacttcttccgggca
cagaccctcaaggagacctccctgacgaacaccatgggcggctacaaggagagtttcagc
agtatcacctgctttggctgtcacgatgtctacgcgcaggccagcctgggcatggacatc
cacgcgtccgacctgagcctcctcactcgcaggaagctcagccgcctgctggacccacct
gaccccatggggaaagactggtgcctcctggccatgaacctgggcctgcccgacctcgtc
gccaagtacaacaccaacagtggggcgcccagggacttcgtccccagcccggtgcacgcc
ctgctgcgggagtggacttcctgccccgagagcacagtgggcatcctcatggccaagctg
agggagctgggccgccgggacgccgccgacttcctgcttaaggcatcctcggtgttccgg
atcaacctcgacggcgccggccccgaggcctacgcctccagctgcaacagcggcacctcc
tacaattccattagctccgtggtgtcccggagagactcccatgcatggaatcccgcggtg
ggatttataaacagacaatatgtgagtgccttttgcagaagagggtgtgtttga

KEGG   Oryctolagus cuniculus (rabbit): 100352862
Entry
100352862         CDS       T03373                                 

Gene name
DAPK2
Definition
(RefSeq) death associated protein kinase 2
  KO
K08803  death-associated protein kinase [EC:2.7.11.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04140  Autophagy - animal
ocu05200  Pathways in cancer
ocu05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100352862 (DAPK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100352862 (DAPK2)
  09162 Cancer: specific types
   05219 Bladder cancer
    100352862 (DAPK2)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100352862 (DAPK2)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: CAMK group
  DAPK family
   100352862 (DAPK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal RIO1 Kdo Spc7 TPR_MLP1_2 AAA_13 HAUS-augmin3 Choline_kinase Glycos_trans_3N
Other DBs
NCBI-GeneID: 100352862
NCBI-ProteinID: XP_008267131
Ensembl: ENSOCUG00000000435
LinkDB
Position
17
AA seq 483 aa
MRSPNMETFKQQKVEDFYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSRASRRG
VCREEIEREVSILRQVLHPNIITLHDVYENRTDVVLILELVSGGELFDFLAQKESLSEEE
ATSFIKQILDGVHYLHTKKIAHFDLKPENIMLLDKNTPIPHIKLIDFGLAHEIEDGVEFK
NIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLSNITAVSYD
FDEEFFSQTSELAKDFIRKLLVKETRKRLTIQEALSHPWITSGGEASAPEQRETEPPQLK
TKRLREYTLKCHSSMPPNNTYVNFERFARVVEDMARVDEGCRALAGAHDTLQDDVETLIS
IYNEKEAWYREENESARHDLSQLRYEFRKVESLKKLLREDLQATSASLGGVARKLERVQE
QFGALRRELSADLQWMQEVVNGFQLEGGRTDGLGSVFHGDASESLSELLSRVCSEEVLGT
VQL
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgaggagcccaaacatggagacgttcaaacagcagaaggtggaggacttctacgacata
ggagaggagctggggagcggtcagttcgccatcgtgaagaagtgccgggagaagagcacg
gggctcgagtacgcagccaagttcatcaagaagcggcagagccgggccagccggcggggc
gtgtgccgggaggagatcgagcgggaagtgagcatcctgcggcaggtgctgcaccccaac
atcatcacgctgcacgacgtctacgagaaccgcaccgacgtggtgctcatcctagagcta
gtgtctggaggagagctctttgacttcctggcccagaaggagtcgctgagtgaggaggag
gccaccagcttcattaagcagatcctggatggggtgcactaccttcacacaaagaaaatt
gctcactttgatctcaagccagaaaatattatgttgctagacaagaatactcccattcca
cacatcaaactcattgactttggcctggctcacgaaatcgaagatggagttgaattcaag
aacatttttgggacgccggaatttgttgctccagagattgtgaactatgagcccctgggc
ctggaagccgacatgtggagcattggcgtcatcacctacatcctcctaagcggagcatcc
cctttcctgggtgacacgaagcaggagacgctgtccaacatcacagcagtgagttacgac
ttcgacgaggagttcttcagccagaccagcgagctggccaaggacttcattcggaagctt
ctggttaaagagacccggaagcggctcaccatccaagaggcgctctctcacccctggatc
acgtcgggaggagaagccagcgcccccgaacagcgggagacggagcccccccagctgaag
accaagcgcctgcgggagtacaccctcaaatgccactcaagcatgccccccaacaacacc
tatgtcaacttcgagcgttttgcccgtgtggtggaggacatggcacgggtggatgagggg
tgccgcgccctggcaggggcccacgacacactccaggacgacgtggagacgctgatctcc
atctacaacgagaaggaggcttggtaccgagaggagaatgagagcgcccggcacgacctg
tcccagctcaggtacgagttccgcaaggtggagtccttgaagaagctcctgcgagaggac
ctccaggccaccagcgccagcctcgggggcgtggcccggaagctggagcgcgtgcaggag
cagttcggggccctgaggcgggagctgtccgcggacctacagtggatgcaggaagtggtg
aacggcttccagctggagggtgggcgcacagatggcctgggctccgtgttccacggggac
gcgagcgaatctctgtcggagctgctcagcagagtctgcagtgaggaagtcctgggcacc
gtgcagctctga

DBGET integrated database retrieval system