KEGG   Oryctolagus cuniculus (rabbit): 100343787
Entry
100343787         CDS       T03373                                 

Gene name
RNASEL
Definition
(RefSeq) ribonuclease L
  KO
K01165  ribonuclease L
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04621  NOD-like receptor signaling pathway
ocu05160  Hepatitis C
ocu05164  Influenza A
ocu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100343787 (RNASEL)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100343787 (RNASEL)
   05160 Hepatitis C
    100343787 (RNASEL)
   05168 Herpes simplex virus 1 infection
    100343787 (RNASEL)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank_5 Ank_3 Ank Ribonuc_2-5A Pkinase PK_Tyr_Ser-Thr RIO1 Kdo APH Kinase-like Seadorna_VP7 Choline_kinase
Other DBs
NCBI-GeneID: 100343787
NCBI-ProteinID: XP_008251854
Ensembl: ENSOCUG00000015922
LinkDB
Position
Un
AA seq 887 aa
MAFAMDTQDRHGPQDGPRPPSSGDGAEADGPSLMAAVAAEDVARIRELLGRGAHVNFQEP
KWGWSPLHSAVQRDQPDIVELLLQHGADPGLRKRNGATPLIVAGLQGNVRVLQLLLARGA
DVNECDAHGFTALMEAAGNGRVEALRFLHQRGARVNLARETTREQQALGKGGATALMDAA
EKGHVEAARALLEMGADVGARDNMGRSALTHALLSCPAERTEDTVRLLLRHCADVNGQDA
EGKTALILAVERRHLGSVRALLEQERLEVDGRDSEGRTALLVATQLDLGEVAQLLCQRGA
SVDCGDLVGIARRNYNNDLARFFLSLGAPERPQVPAQDWRPQSRRWGAALSSLHGMNRPM
IGKLKIFLDQDYQIAPTTEGGLYLGLYEAQEVAVKVFAVGSRRARQELSCLQSGRPSSHL
LTLYGCESHRGRQYVCVALCEWTLEEYLHEHRQEAVENQEDLRARRVLATLLAAVRELHM
CCGYAHGDLQPQNILVDTRGNFRLADFDQSVQLAGAAPEVRRDLEALGRLVLYVVQNGDV
PFKELKAKPPGEVVHRCPDEESKDLARQLLRPGDDVGDLLGRLLDHPFFWPWQDRFRTLR
NVGNESDIKSRKPGSRLLQLLQPGPSERHTSFARWTRKIHKGVMRDMNAFYKDSGSFYKN
SVGDLLKFIRNIGEHIHEDRNRRMKAQIGDPACYFQKTFPDLLMYVYRKLRDTEYREHFP
QLTPHAGLCVAEVAGPAGPGPECWPLRRVTRRHTGILMGSGQGQGPKTTPTPPHRSFRGA
ASAGGSVPAPSPVLSLASSTRSHGAPAAVPVPTSSGVLAAPVCYLSEAPARPLTPREPGG
TDDARGPAQTCPCRDSFPGHRTRTLCLAPVVQLTGPGELPGVGVGGS
NT seq 2664 nt   +upstreamnt  +downstreamnt
atggcgttcgccatggacacccaggaccgtcacggcccccaggacggacccaggcccccc
agcagcggggacggggcggaagccgacggcccctccctgatggccgcggtcgcggctgag
gacgtggcgcggatccgggagctgctggggcgtggggcccacgtcaacttccaggagccg
aagtggggctggtcgcccctgcacagcgcggtgcagcgggaccagccggacatcgtggag
ctgctgctgcagcatggcgccgaccccgggctgcgcaagaggaacggggccacgccgctg
atcgtcgcggggctgcagggcaacgtgcgtgtgctccagctcctcctggctcgaggcgcg
gacgtgaacgagtgcgacgcccacggcttcactgcgctcatggaggccgcagggaatggg
cgggtcgaggccctgcggttccttcaccagaggggcgcgcgggtgaatctggcccgagag
accacgcgggagcagcaggcgctgggcaagggcggcgccacggccctcatggacgcggcc
gagaagggccacgtggaggcggcgcgggcgctcctggagatgggcgcggacgtgggcgcc
cgggacaacatgggccgcagcgcgctcacgcatgcgctgctgagctgcccggcggagcgc
accgaggacacggtccgcctcttgctgcggcattgcgcggacgtgaacgggcaggacgcc
gagggcaagacggccctgatcctggctgtggagaggcggcacctgggctcggtgagggcg
ctcctggagcaagagcgcctcgaggtggatggcagggacagcgaggggaggacggcgctg
ctcgtggccacccagctcgacctgggcgaggtggcccagctgctgtgccaaagaggggcc
agcgtggactgcggggacctggtcggcatcgccaggaggaattacaacaacgacctcgcc
cggttctttctcagtcttggagctccagagcgaccgcaggtccccgcccaggactggagg
ccccagagccggcgctggggggcagccctgagcagtctccacgggatgaaccgtcccatg
attggcaagctcaagatctttctcgaccaggactaccagatcgcgcccacgaccgaaggg
ggcctctacctggggctgtacgaggcccaggaggtggcggtgaaggtgttcgcggtgggc
agcaggcgggcacgccaggagctgtcctgcctgcagagcggccggcccagcagccacctg
ctgacgctgtacgggtgcgagagccaccggggccgccagtacgtgtgtgtggcgctgtgc
gagtggacgctggaggagtacctgcacgagcaccggcaggaggctgtggagaaccaggag
gacctacgtgcccggagggtgctggccacgctgctcgcggctgtccgggagctgcacatg
tgctgcggctatgcccatggggacctgcagccacagaacatcctcgtggacaccaggggc
aattttcgcctggcggatttcgaccagagtgtccagttggccggagccgcgccggaggtc
aggcgggatcttgaggccctggggcggctggtcctctacgtggtccagaacggggacgtg
cccttcaaggagctgaaggccaaacctcctggtgaggttgtgcaccgctgtccagacgag
gagagcaaggacctcgcccgccagctgctgcgcccgggggacgacgtgggggacctgctc
ggccgcctgctggaccaccccttcttctggccatggcaggaccgcttcaggacgcttcgg
aacgtgggcaacgaatctgacatcaaaagtcggaagcctggaagccggctcctacagctg
ctgcagcccgggccctcagagcgccacacaagcttcgcccgctggacccggaagatccac
aagggcgttatgagggacatgaacgcgttctacaaagacagcggcagtttctacaagaac
agcgtgggggacctgctcaagttcatccggaacatcggggagcacatccacgaggacagg
aacaggaggatgaaggcgcaaatcggagaccctgcctgctacttccagaagacatttcca
gatctgctgatgtacgtgtacaggaagctgcgggacacggaatacagggagcactttccc
cagctcactccacacgctggcctctgtgtggcagaggtggctgggccggcgggaccaggc
cctgagtgctggcccctgagacgggtgacgcggcgacatactggcattttgatgggcagc
ggccagggacagggcccaaagacaacccccacccccccacacagaagcttccgaggggct
gcgtctgcagggggcagcgtccctgccccctccccggtgctctctctggcttcctccacc
cggagccacggtgcacctgctgcggtacctgtgcccacctcgtctggagtcctggcggcc
cctgtgtgctatctcagcgaggctccagcacggccgctcaccccgagggagccgggaggg
actgacgacgccagagggccagctcagacctgtccctgccgtgactccttcccgggtcac
cggaccagaacgctgtgcttggctccagtggtgcagctgacaggtcctggggagcttccc
ggggtgggggtgggtggaagctga

DBGET integrated database retrieval system