KEGG   Oryctolagus cuniculus (rabbit): 100343949
Entry
100343949         CDS       T03373                                 

Gene name
CD82
Definition
(RefSeq) CD82 molecule
  KO
K06509  CD82 antigen
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100343949 (CD82)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100343949 (CD82)
   04090 CD molecules [BR:ocu04090]
    100343949 (CD82)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100343949 (CD82)
  Exosomal proteins of other body fluids (saliva and urine)
   100343949 (CD82)
  Exosomal proteins of colorectal cancer cells
   100343949 (CD82)
CD molecules [BR:ocu04090]
 Proteins
  100343949 (CD82)
SSDB
Motif
Pfam: Tetraspanin
Other DBs
NCBI-GeneID: 100343949
NCBI-ProteinID: XP_017201622
Ensembl: ENSOCUG00000000861
LinkDB
Position
1
AA seq 267 aa
MGAACVKVTKYFLFLFNLLFFILGAVILGFGVWILADRSSFISVLQTSSSSLKMGAYIFI
GVGAVTMFMGFLGCLGAINEVRCLLGLYFAFLLLILIAQVTAGVLFYFNVGKLKQEMGGI
VTEIIRNYNASGEDSLQEAWDYVQAQVRCCGWVSFYNWTDNAELMNHTEVTYPCSCEDKG
GEDDGLPVGQGFCQADGNSTQSGNSPEDWPVYQAGCMEKVQAWLQENLGVILGVCVGVAV
IELLGMLLSVCLCRHIHSEDYSKVPKY
NT seq 804 nt   +upstreamnt  +downstreamnt
atgggggcagcctgtgtcaaagtcaccaaatacttcctcttcctgttcaacttgctcttc
tttatcctgggcgccgtgatcctgggcttcggggtttggatcctggccgacaggagcagc
ttcatctctgtcctgcagacgtcctccagctcgctcaagatgggagcctacatcttcatc
ggcgtgggggcggtcaccatgttcatgggcttcctgggctgccttggcgccatcaacgag
gtccgctgcctgctggggctgtacttcgccttcctcctcctgatcctcatcgcccaggtg
actgcgggggtcctcttctacttcaacgtgggcaagctgaagcaggagatgggtggcatc
gtgaccgagatcatccggaactacaacgccagcggcgaggacagcctgcaggaggcctgg
gactacgtgcaggctcaggtgcggtgctgcggctgggtcagtttctacaactggacagac
aacgccgagctcatgaatcacaccgaagtcacctacccctgctcctgcgaggacaagggg
ggcgaggacgacgggctgccggtgggacagggcttctgccaggccgacggcaacagcacc
cagagcggcaacagcccggaggactggcccgtgtaccaggcgggctgcatggagaaggtg
caggcgtggctgcaggagaacctgggcgtcatccttggcgtgtgtgtgggcgtcgccgtc
atcgagctcctggggatgctgctgtccgtgtgcctgtgccggcacatccactccgaggac
tacagcaaggtccccaagtactga

DBGET integrated database retrieval system