KEGG   Oryctolagus cuniculus (rabbit): 100344073
Entry
100344073         CDS       T03373                                 

Gene name
FASLG
Definition
(RefSeq) Fas ligand
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04068  FoxO signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04210  Apoptosis
ocu04217  Necroptosis
ocu04650  Natural killer cell mediated cytotoxicity
ocu04722  Neurotrophin signaling pathway
ocu04932  Non-alcoholic fatty liver disease
ocu04940  Type I diabetes mellitus
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05142  Chagas disease
ocu05143  African trypanosomiasis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05320  Autoimmune thyroid disease
ocu05330  Allograft rejection
ocu05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100344073 (FASLG)
   04014 Ras signaling pathway
    100344073 (FASLG)
   04068 FoxO signaling pathway
    100344073 (FASLG)
   04151 PI3K-Akt signaling pathway
    100344073 (FASLG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100344073 (FASLG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100344073 (FASLG)
   04217 Necroptosis
    100344073 (FASLG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100344073 (FASLG)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100344073 (FASLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100344073 (FASLG)
   05205 Proteoglycans in cancer
    100344073 (FASLG)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100344073 (FASLG)
   05330 Allograft rejection
    100344073 (FASLG)
   05332 Graft-versus-host disease
    100344073 (FASLG)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    100344073 (FASLG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100344073 (FASLG)
   04932 Non-alcoholic fatty liver disease
    100344073 (FASLG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100344073 (FASLG)
   05162 Measles
    100344073 (FASLG)
   05164 Influenza A
    100344073 (FASLG)
   05161 Hepatitis B
    100344073 (FASLG)
   05160 Hepatitis C
    100344073 (FASLG)
   05168 Herpes simplex virus 1 infection
    100344073 (FASLG)
   05163 Human cytomegalovirus infection
    100344073 (FASLG)
   05165 Human papillomavirus infection
    100344073 (FASLG)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100344073 (FASLG)
   05143 African trypanosomiasis
    100344073 (FASLG)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100344073 (FASLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100344073 (FASLG)
   04052 Cytokines and growth factors [BR:ocu04052]
    100344073 (FASLG)
   04090 CD molecules [BR:ocu04090]
    100344073 (FASLG)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100344073 (FASLG)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Tumor necrosis fators
   100344073 (FASLG)
CD molecules [BR:ocu04090]
 Proteins
  100344073 (FASLG)
SSDB
Motif
Pfam: TNF Lectin_N
Other DBs
NCBI-GeneID: 100344073
NCBI-ProteinID: XP_008262009
Ensembl: ENSOCUG00000028219
LinkDB
Position
13
AA seq 285 aa
MQQPFSYPYPQIYWVDSTASSPWAPPGSVLPCPSSVPERPGQRRPPPPLPPPPPPLPPPP
LPPLPPLPPLPPPPLKKRKDHSTGLCLLLMFFMVLVAXVGLGWDVQLYHLQXELAELRES
FSQRHTASSSMEKQTAHPSPPQEKKETKKVAHLTGKSNSRSNPLEWEDTYGIALVSGLKY
KKGNLVINDTGLYFVYSKVYFRGQSCSNQPLTHKVYMKNSKYHQDLMLMEEKMMNYCTTG
QMWARSSYLGAVFNLTSADHVYVNVSEISLVNFEESKTFFGLYKL
NT seq 858 nt   +upstreamnt  +downstreamnt
atgcagcagcccttcagttatccatatccccaaatctactgggtggacagcactgccagc
tctccctgggcccctccagggtcagttctcccctgtccatcctctgtacctgaaaggcct
ggtcaaagaaggccaccaccaccactgccaccgccgccgccaccgctaccaccaccacca
ctgcccccgctgcccccactgcccccgctgcccccaccacccctgaagaagaggaaggac
cacagcacaggcctctgcctccttctgatgtttttcatggtcctggtggccnctgttgga
ttgggctgggatgtccagctctaccacctgcagnaagagttggccgagctcagagagtcc
ttcagtcaaaggcacacagcatcatcatctatggagaagcaaacagctcacccaagtcca
cctcaagaaaaaaaggagaccaagaaagtggcccacttaacaggcaagtccaactcaagg
tccaaccctttggaatgggaagacacctatggaattgccctggtttccggactgaagtat
aagaagggcaaccttgtgatcaatgacactgggctgtactttgtgtattctaaagtgtac
ttccgtggccagtcctgcagcaaccagccactgacccacaaagtctacatgaaaaactct
aagtatcaccaggatctgatgctgatggaagagaagatgatgaactactgtactactggc
cagatgtgggcccggagcagctacctgggggcagtgtttaatctcaccagtgccgaccat
gtatatgtcaatgtctctgagatatcactggtcaattttgaggaatcaaagacattcttt
ggtttatataagctctga

DBGET integrated database retrieval system