KEGG   Oryctolagus cuniculus (rabbit): 100344328
Entry
100344328         CDS       T03373                                 

Gene name
SESN1
Definition
(RefSeq) sestrin 1
  KO
K10141  sestrin 1/3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04115  p53 signaling pathway
ocu04211  Longevity regulating pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100344328 (SESN1)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    100344328 (SESN1)
SSDB
Motif
Pfam: PA26 CMD HEAT
Other DBs
NCBI-GeneID: 100344328
NCBI-ProteinID: XP_008261562
Ensembl: ENSOCUG00000011814
UniProt: G1T215
LinkDB
Position
12
AA seq 551 aa
MAEGENEVRWDGLCSRDPAVRETALENIRQIVLRKTECLCSLEGPPSRPPDGHSDAASVD
GLNKLLARLLMLSKRCPFKDVRERSEFILKSAQELGIRIPRPLGHGPSRFIPEKEILQVG
SEDAQMHALFADSFAALGRLDNITLVMVFHPQYLESFLKTQHYLLQMDGPLPLHYRHYIG
IMAAARHRCSYLVNLHVSDFLHVGGDPKWLNGLENAPPKLQNLGELNKVLAHRPWLITKE
HIEGLLKAEEHSWSLAELVHAVVLLTHYHSLASFTFGCGISPEIHCDGGHTFRPPSVSNY
CICDITNGNHSVDETQVNSAGNVSVSDSFFEVEALMEKMKQLQECRDEEEASQEEMASRF
EIEKRESMLVLSSDDEEVSPARDVSRHFEDTSYGYKDFSRHGMHVPTFRVQDYCWEDHGY
SLVNRLYPDVGQLIDEKFHIAYNLTYNTMAMHKDVDTSMLRRAIWNYIHCMFGIRYDDYD
YGEINQLLDRSFKVYIKTVVCTPEKVTKRMYDSFWRQFKHSEKVHVNLLLIEARMQAELL
YALRAITRYMT
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggctgaaggggagaatgaagtgaggtgggacggactgtgcagccgagatcccgctgtc
cgagagacggccctggagaacattaggcaaatcgttttgcgaaagaccgagtgtctgtgt
tcgctggaggggccaccttctcgtccacccgacgggcattcggacgccgcctctgtggac
gggctgaataagctgctcgctcggctactgatgctttccaaaaggtgtccctttaaagac
gtgagagagaggagtgagtttatcctgaagagcgcccaggaacttggaattagaattcct
cgaccactaggacacggaccaagcagattcatcccagaaaaggagattctccaagtgggg
agtgaagacgcacagatgcatgctttatttgcagattcttttgctgctttgggtcgtttg
gataacatcacattagtgatggttttccacccacaatatttagaaagtttcttaaaaact
caacactatctactgcaaatggatgggccattacccctacattatcggcactacattgga
ataatggctgcagcaagacatcggtgctcctacctagtgaacctgcatgtgagcgacttc
ctccacgttggtggggaccccaagtggctcaacggcttagaaaatgcgcctcccaaactg
cagaacttaggagaactcaacaaagtgttagcccatagaccctggctcattaccaaagag
cacattgagggacttttaaaagctgaggagcacagctggtcccttgcagaactggtccac
gcggtggttctgctcacacactaccattctcttgcctcattcacgtttggctgtggaatc
agtccagaaattcattgtgatggtggccacacattcagacctccttctgtgagtaactac
tgcatctgtgacattacaaatggcaatcacagtgtggatgagacgcaggtcaactcagca
ggaaatgtttcggtaagtgattccttctttgaggtggaagccctcatggaaaagatgaag
cagttacaggaatgcagagatgaagaggaggcaagccaagaagagatggcttcacgtttt
gaaatagaaaagagagagagcatgctggtcctctcatcagatgatgaagaagtttcacca
gcaagagatgtgtctcgtcactttgaggatactagttatggctataaagatttctctcga
catgggatgcatgttccaacatttcgagtccaggactattgctgggaagaccacggctat
tctttggtaaatcgcctttaccctgacgtgggacagttgattgatgaaaaatttcacatc
gcttacaatcttacttataacacaatggcaatgcacaaagatgttgatacctcaatgctt
agacgggctatttggaactatattcactgcatgtttggcataaggtatgatgactatgac
tatggtgaaattaaccagcttttggatcgtagctttaaagtttatatcaaaactgttgtt
tgcactcctgaaaaggttaccaaaagaatgtatgacagcttctggaggcagttcaagcac
tctgagaaggttcatgttaatctgcttcttatagaagctcggatgcaagcagaactcctt
tatgctctgagagccattactcgctatatgacctga

KEGG   Oryctolagus cuniculus (rabbit): 100353543
Entry
100353543         CDS       T03373                                 

Gene name
SESN2
Definition
(RefSeq) sestrin 2
  KO
K20394  sestrin 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04115  p53 signaling pathway
ocu04150  mTOR signaling pathway
ocu04211  Longevity regulating pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    100353543 (SESN2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100353543 (SESN2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    100353543 (SESN2)
SSDB
Motif
Pfam: PA26 CMD
Other DBs
NCBI-GeneID: 100353543
NCBI-ProteinID: XP_002716127
Ensembl: ENSOCUG00000014896
UniProt: G1T8B8
LinkDB
Position
13
AA seq 480 aa
MIVADSECCAELKGYLPFARDGGGGPGAGQEQSESRARQGPRGPSAFIPVEEVLREGAES
LEQHLGLEALMSSGRVDNLAVVMSLHPDYLSSFWRLHYLLLHTDGPLASSWRHYIAIMAA
ARHQCSYLVGSHMTEFLQTGGDPEWLLGLHRAPEKLRKLSEINKLLAHRPWLITKEHIQA
LLKTGEHSWSLAELIQALVLLTHCHSLASFVFGCGILPEGDPDGSPGPQAPSPLSEQSSP
PSGDALNNSGGLEAARDVEALMERMRRLQDSLLRDEGTSPEEMESRFELEKSESLLVAPA
ADILEPSPHPDTLCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYSLIQRLYPEGG
QLLDEKFQVACSLTYNTIAMHSGVDTSVLRRAIWNYIHCVFGIRYDDYDYGEVNQLLERN
LKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQAALLYALRAITRYMT
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgatcgttgcagactccgagtgctgtgccgagctcaagggctacctgccgttcgcccgg
gacggcggcggcggcccgggcgcagggcaggagcagagcgaaagccgggcccggcaaggc
cctcgtgggcccagcgccttcatcccagtggaggaggtgcttcgggagggagctgagagc
ctggagcagcacctggggctggaggcattgatgtcttcagggcgggtggacaacctggcg
gtggtgatgagtctgcaccctgactaccttagcagcttttggcgccttcactacctgctg
ctacacacggacgggcccctggcaagctcctggcgccactacattgccatcatggctgcc
gcccgccaccagtgttcctaccttgtgggctcccacatgaccgagtttctgcagactggc
ggtgaccctgagtggctgctgggcctccaccgggcccctgagaagctgcgcaaactcagc
gagatcaataagctcctggcacatcggccgtggctcatcaccaaggagcacatccaggcc
ttgctgaagacgggcgagcacagctggtccctggctgaactcatccaggccctggtcctg
ctcacccactgccactcgctggcctccttcgtctttggctgtggcatcctccctgaggga
gacccagacggcagccctggcccccaggccccttcaccgctcagtgagcaaagcagcccc
ccaagtggggacgcactgaacaactctgggggcctggaggccgcgcgcgacgtggaggcg
ctgatggagcgcatgcggcggctgcaggacagcctgctgcgggacgagggcacgtccccg
gaggaaatggagagccgcttcgagctggagaagtcagagagcctgctggtggccccggca
gctgacatcctggagccctctccacacccagacacgctgtgctttgtggaagaccccact
ttcgggtacgaggacttcacccggcgtggggcccaggcgccccccaccttccgcgcccag
gattacacctgggaggaccacggctactcgctgatccagcgcctgtaccccgagggtggg
cagctgctggacgagaagttccaggtggcctgtagcctcacctacaacaccatcgccatg
cacagcggcgtggacacctccgtgctccgcagggccatctggaactacatccactgcgtc
tttggcatcaggtatgatgactacgattacggggaggtgaaccagctcctggagcggaac
ctcaaggtctacatcaagacggtggcctgttacccagagaagaccacccgccgaatgtac
aacctcttctggagacacttccgccactcagagaaggtccacgtgaacctgctgctcctg
gaggcccgcatgcaggccgccctgctctatgccctccgcgccatcacccgctacatgacc
tga

KEGG   Oryctolagus cuniculus (rabbit): 100354919
Entry
100354919         CDS       T03373                                 

Gene name
SESN3
Definition
(RefSeq) sestrin 3
  KO
K10141  sestrin 1/3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04115  p53 signaling pathway
ocu04211  Longevity regulating pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100354919 (SESN3)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    100354919 (SESN3)
SSDB
Motif
Pfam: PA26 CMD PEX11
Other DBs
NCBI-GeneID: 100354919
NCBI-ProteinID: XP_002708667
Ensembl: ENSOCUG00000026640
UniProt: A0A5F9DK86
LinkDB
Position
1
AA seq 492 aa
MNRSGGSPSAAANYLLCTNCRKVLRKDKRIRVSQPLTRGPSAFIPEKEVVQANTVDERTN
FLVEEYSTSGRLDNITQVMSLHTQYLESFLRSQFYMLRMDGPLPLPYRHYIAIMAAARHQ
CSYLINMHVDEFLKTGGIAEWLNGLEYVPQRLRNLNEINKLLAHRPWLITKEHIQKLVKT
GENNWSLPELVHAVVLLAHYHALASFVFGSGINPERDPEISNGFRLISVNNFCVCDLAND
NNIENASLTGSNFGIVDSLSELEALMERMKRLQEEREDEEASQEEMTTRFEKEKKESLFV
VSGDNFHSFPHSDFEDDMIVTSDVSRYIEDPGFGYEDFARRGEEHLPTFRAQDYTWENHG
FSLVNRLYSDIGHLLDEKFRMVYNLTYNTMATHEGVDTTMLRRALFNYVHCMFGIRYDDY
DYGEVNQLLERSLKVYIKTVTCYPERTTKRMYDSYWRQFKHSEKVHVNLLLMEARMQAEL
LYALRAITRHLT
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgaaccggagcggcggcagcccgtcggccgccgccaactacctgctctgtaccaactgc
cggaaagtgctgcggaaggataaaagaatcagagtatctcaacccttgacaagaggacca
agtgcctttattccagagaaggaagttgtccaagcaaacacagtggacgaacgtactaac
tttcttgtggaagaatactccacatctggccgtctggacaacatcacgcaggtcatgagt
ttgcatactcagtacctggagtctttcctgcggagccagttctacatgttgcgcatggat
ggcccccttcctctaccatacaggcactacatcgcaataatggctgcagccagacatcag
tgttcttacttaataaacatgcatgtggatgaatttttaaagactggaggtattgctgaa
tggttgaatggtttggaatatgtaccacaaagactgagaaatcttaatgaaataaataag
ctgctagcacaccgaccctggctgattacaaaagagcatattcagaaacttgtcaaaact
ggagaaaataactggtctctgcctgaactggtacatgctgtggtcctactagcacattat
catgctttggcaagctttgtttttggcagtggcatcaatccagaaagagatccagaaatc
tccaatggattcaggctaatatcagtcaacaatttctgtgtttgtgatcttgctaatgac
aacaatattgaaaatgcatcccttacaggcagcaattttgggattgtggattctctaagt
gaactagaggccttaatggaaaggatgaaaaggcttcaggaagaaagggaagacgaagag
gcatcccaggaagaaatgaccacccgttttgagaaggagaagaaagaaagcctttttgtg
gtctctggagataattttcattcatttcctcattcagattttgaggatgacatgattgta
acatctgatgtctctcgatatattgaagacccgggttttgggtatgaagattttgccaga
cgaggagaagagcatctgccaacattccgagctcaggattatacttgggaaaatcatggg
ttctctctggtgaatagactttattctgacattggacatcttcttgatgaaaagtttcga
atggtctacaatctcacctataacactatggccacccatgaaggtgttgacacaaccatg
ctgcgcagagctttgtttaattatgttcactgtatgtttggaatcaggtatgatgactat
gattatggagaagttaaccaattacttgaacgaagcctgaaggtttacattaagacagtg
acctgctatcctgagagaaccacaaagcgcatgtatgatagttactggcggcaattcaag
cactcagaaaaggtccatgtaaatctactcttaatggaagcccggatgcaagctgaactt
ctttatgctcttcgtgccataactcggcatttaacctga

DBGET integrated database retrieval system