KEGG   Oryctolagus cuniculus (rabbit): 100344335
Entry
100344335         CDS       T03373                                 

Gene name
TGFBR2
Definition
(RefSeq) transforming growth factor beta receptor 2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04068  FoxO signaling pathway
ocu04144  Endocytosis
ocu04218  Cellular senescence
ocu04350  TGF-beta signaling pathway
ocu04380  Osteoclast differentiation
ocu04390  Hippo signaling pathway
ocu04520  Adherens junction
ocu04659  Th17 cell differentiation
ocu04926  Relaxin signaling pathway
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu05142  Chagas disease
ocu05161  Hepatitis B
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05202  Transcriptional misregulation in cancer
ocu05210  Colorectal cancer
ocu05212  Pancreatic cancer
ocu05220  Chronic myeloid leukemia
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100344335 (TGFBR2)
   04350 TGF-beta signaling pathway
    100344335 (TGFBR2)
   04390 Hippo signaling pathway
    100344335 (TGFBR2)
   04068 FoxO signaling pathway
    100344335 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100344335 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100344335 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    100344335 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100344335 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100344335 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100344335 (TGFBR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100344335 (TGFBR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100344335 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    100344335 (TGFBR2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100344335 (TGFBR2)
   05212 Pancreatic cancer
    100344335 (TGFBR2)
   05225 Hepatocellular carcinoma
    100344335 (TGFBR2)
   05226 Gastric cancer
    100344335 (TGFBR2)
   05220 Chronic myeloid leukemia
    100344335 (TGFBR2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100344335 (TGFBR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100344335 (TGFBR2)
   05161 Hepatitis B
    100344335 (TGFBR2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100344335 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100344335 (TGFBR2)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100344335 (TGFBR2)
Protein kinases [BR:ocu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   100344335 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 100344335
NCBI-ProteinID: NP_001171219
Ensembl: ENSOCUG00000015963
UniProt: D5LXX2
LinkDB
Position
14
AA seq 567 aa
MGRGLLRGLWPLHIVLWTRIASTIPPHVHKSVNNDMMVTDNNGAVKFPQLCKFCDVRSST
CDNQKSCMSNCSITSICEKAHEVCVAVWRKNDENITLETVCHDPKLAYHGFLLEDSASPK
CIMKEKKVFGETFFMCSCSTDECNDHIIFSEEYTTSSPDLLLVIFQVTGVSLLPPLGIAI
AVIVTFYCYRVHRQQKLSPSWETSKPRKLMEFSEHCAIILEDDRSDISSTCANNINHNTE
LLPIELDTLVGKGRFAEVYKAKLRQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLK
HENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLARGIAH
LHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG
TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVRE
HPCVESMKDNVLRGRGRPEIPSFWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSE
LEYLDRLSGRSCSEEKIPEEGSLNTTK
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgggtcgggggctgctccggggcctgtggccgctgcatatcgtcctgtggacgcgcatc
gccagcacgatccccccgcacgttcataagtcggttaataacgacatgatggtcacggac
aacaatggcgccgtcaagttcccacaactgtgcaagttttgcgatgtgcgatcttccacc
tgtgacaaccagaagtcctgcatgagcaactgcagcatcacgtccatctgtgagaaggca
cacgaagtctgcgtggccgtctggaggaagaacgatgaaaacataaccctggagactgtg
tgtcacgaccccaagctcgcctaccatggattccttctggaagattctgcctctccaaag
tgtatcatgaaagaaaagaaggtgtttggggagactttcttcatgtgttcctgcagcact
gacgagtgcaatgaccacatcatcttctctgaggaatacaccaccagcagtccggatctg
ctgctagtcatatttcaagtgaccggcgtcagcctcctgccaccgctgggaattgccatc
gccgtcatcgtcaccttctactgctaccgcgttcaccggcagcagaagctgagtccctcc
tgggagaccagcaagccgcggaagctcatggagttcagcgagcactgcgccatcattctg
gaagacgaccgctccgacatcagctccacgtgcgccaacaacatcaaccacaacacggag
ctgctgcccatcgagctggacaccctggtgggcaaaggtcgattcgccgaggtctacaag
gccaagctgaggcagaacacatccgagcagttcgagaccgtggccgtcaagatcttcccc
tacgaggagtacgcctcttggaagacggagaaagacatcttctcggacatcaacctgaag
cacgagaacatcctgcagttcctgacggccgaggagcgcaagactgagctcgggaagcag
tactggctgatcaccgccttccatgccaagggcaacctgcaggagtatctcacacgccac
gtcatcagctgggaggacctgcgcaagctgggcagctccctggcccggggcattgcccac
ctccacagcgaccacaccccctgtgggaggcccaagatgcccatcgtgcatagagacctc
aagagctccaacatcctggtgaagaacgacctgacctgctgcctgtgtgactttgggctg
tccctgcgcctggaccctacgctgtctgtggatgacctggctaacagtgggcaggtgggg
actgcaagatacatggcgccggaagtcctggaatccaggatgaatctggagaacgtggag
tccttcaagcagactgatgtctactccatggcgctggtgctctgggaaatgacgtcccgc
tgcaatgcggtgggggaggtcaaagattacgagcctccgtttggttccaaggtgcgggag
cacccctgtgtggagagcatgaaagacaatgtgctgcgaggtcgaggtcgaccagaaatc
cccagcttctggcttaaccaccagggcatacagatggtgtgtgagacactgaccgaatgc
tgggaccatgacccggaggcccgtctcacggcccagtgcgtggcggaacgcttcagcgag
ttggagtacctggacagactctcgggaaggagctgctctgaggagaagattccagaagaa
ggctcacttaacactaccaaatag

DBGET integrated database retrieval system