KEGG   Oryctolagus cuniculus (rabbit): 100344432
Entry
100344432         CDS       T03373                                 

Gene name
IRF9
Definition
(RefSeq) interferon regulatory factor 9
  KO
K04693  interferon regulatory factor 9
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04217  Necroptosis
ocu04380  Osteoclast differentiation
ocu04621  NOD-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu05160  Hepatitis C
ocu05162  Measles
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100344432 (IRF9)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100344432 (IRF9)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100344432 (IRF9)
   04625 C-type lectin receptor signaling pathway
    100344432 (IRF9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100344432 (IRF9)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100344432 (IRF9)
  09172 Infectious disease: viral
   05162 Measles
    100344432 (IRF9)
   05164 Influenza A
    100344432 (IRF9)
   05160 Hepatitis C
    100344432 (IRF9)
   05168 Herpes simplex virus 1 infection
    100344432 (IRF9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100344432 (IRF9)
   05169 Epstein-Barr virus infection
    100344432 (IRF9)
   05165 Human papillomavirus infection
    100344432 (IRF9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100344432 (IRF9)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    100344432 (IRF9)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 100344432
NCBI-ProteinID: XP_002718143
Ensembl: ENSOCUG00000028186
LinkDB
Position
17
AA seq 396 aa
MGSGRARCTRKLRNWVVEQVESGKFPGVCWDDAAKTMFRIPWKHAGKQDFREDQDAAFFK
AWAMFKGKYKEGDPGGPAAWKTRLRCALNKSSEFEEVPKRGRMDVAEPYKVYRLLPPGTP
SAQPGTRKSASRRHHSSVSFEREEDEGITSNCMVNPASLQDSLDNAEMVATGEANHSDAG
NSSSSSNGGGSPEPQEGANVTEAAVQGDMVASELLLPPDPDYSLLLTFIYNGRVVGEARV
HSLDCRLVAEPLSSERNMEQVVFPKPDPLEPTQRLLSQLDRGLLVASNSRGLFAQRLCPV
FVSWDAPQVPPGPGLHLLPSNECVELFKTAYFCRDLARYLQGLGPPPKFQVTLNFWEERP
GPSHTAQSLITVQMEQAFARHLLETPEEQAAILSLV
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgggatcgggcagggcacgatgcacccggaagctccggaactgggtggtggagcaagtg
gagagcgggaagttcccaggtgtgtgctgggacgatgcagctaagaccatgttccggatt
ccctggaaacacgcgggcaagcaggacttccgggaggaccaggatgccgccttcttcaag
gcctgggccatgtttaaaggcaagtacaaagagggagacccaggaggccctgctgcctgg
aagactcgcctgcgctgtgccctcaacaagagttctgaatttgaggaggttcccaagaga
ggccgaatggatgttgctgagccctacaaggtgtatcggctgctgccaccaggaactcca
tctgcccagccagggacccggaaatcagcatcaaggcgacaccacagttctgtgtctttt
gagagggaggaagatgagggtatcacaagcaactgcatggtcaatcccgcctccctccag
gactccctggataacgcagagatggtggccactggggaagcaaaccactcagacgccggg
aacagcagcagcagtagcaacggcggtggcagcccagagccacaggaaggtgcgaatgta
actgaggctgctgtgcaaggggatatggtggcctcggagcttctgctccctccagaccca
gactactcgctgctgctcaccttcatctacaacgggcgtgtggtgggtgaagcacgggtg
cacagcctcgactgccgcctcgtggccgagcccttaagctctgagaggaacatggaacag
gtggtgtttcccaagcctgaccccctggagcccacccagcgcctgctgagccagctagac
cgaggcctcctggtggccagcaactcccgaggcctctttgctcagcggctttgccccgtc
ttcgtctcctgggatgcaccgcaggtcccgcctgggccaggcctgcatctgctgcccagc
aatgagtgtgtggagctcttcaagactgcctacttctgcagagacttggccaggtacctc
cagggcctgggccccccacccaagttccaggtgacactgaatttctgggaggagcgcccc
ggccccagccacactgcacagagtcttatcacagtgcagatggagcaagcttttgcccga
cacttactggagaccccagaggagcaggcagccattctgtccctggtgtag

DBGET integrated database retrieval system