KEGG   Oryctolagus cuniculus (rabbit): 100344504
Entry
100344504         CDS       T03373                                 

Gene name
PLCE1
Definition
(RefSeq) phospholipase C epsilon 1
  KO
K05860  phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00562  Inositol phosphate metabolism
ocu01100  Metabolic pathways
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04020  Calcium signaling pathway
ocu04024  cAMP signaling pathway
ocu04070  Phosphatidylinositol signaling system
ocu04919  Thyroid hormone signaling pathway
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu05205  Proteoglycans in cancer
Module
ocu_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100344504 (PLCE1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100344504 (PLCE1)
   04015 Rap1 signaling pathway
    100344504 (PLCE1)
   04020 Calcium signaling pathway
    100344504 (PLCE1)
   04070 Phosphatidylinositol signaling system
    100344504 (PLCE1)
   04024 cAMP signaling pathway
    100344504 (PLCE1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100344504 (PLCE1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100344504 (PLCE1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100344504 (PLCE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100344504 (PLCE1)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100344504 (PLCE1)
Membrane trafficking [BR:ocu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100344504 (PLCE1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100344504 (PLCE1)
SSDB
Motif
Pfam: PI-PLC-X PI-PLC-Y RasGEF RA C2 EF-hand_like
Other DBs
NCBI-GeneID: 100344504
NCBI-ProteinID: XP_017203919
Ensembl: ENSOCUG00000001816
UniProt: G1SG66
LinkDB
Position
18
AA seq 2300 aa
MTSEEMAASVTPATQRKVVSALSTAEESKEKASGIGVPKVCTGRQSRQLPHSISQLNTFK
EDCSRSHLPEVISIAREKIVSDENSNERCWEQSVPESMKNLNISCSSLLRNHQHGLPPSQ
FYETCDSVTEQDLCLETGIPSPLERKVFPGIQLEIAGPPMDISPLGNHPAVMETDGSHPG
SNVALLHFHYEVDRRTSDTFCTMAENLTLDDCGNCVPLPPVEGEQKKNYMAYTSQLAGLA
QSCDNQNGQLPCGHCDTLNEKYLCFEGTCQKVDGVCSSDSFDKEDFTASPPAKTFLSQFE
HFPDNCEEVEDFFKSKKERSTLLVRRFCKNDREVKKSVYTGTRAIVRTLPSGHIGRVAWS
YVDQKRNALLVSRGRVTEPLSSLEMRQGGSHHLSEAPWYLIYHAVRREETENPVGSLLRF
FTKLPASETAHGRVSLGPCLKQCVRDTVCEYRATLQRTSISQYVTGSLLEATTSLGTRSG
LLSTFGGSAGRMMLKERQPGTSMASSNALPSSSAGISKELIDLQPLIQFPEEVASILTEQ
EQNIYRKVLPVDYLCFLTRDLGTPECQRSLPCLKASISASILTSQNGERNALEDLVMRFN
EVSSWVTWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAGLRSRKVLKMWQF
MEQSDMDTMRSLKDAMALHESSREYRKAVTRALHIPGCRVVPFCGVFLKELCEVLDGASG
LMKLCPRYNSQEETLEFVADYSGQDNFLQRVGQNGLKNSEKESTVNSIFQVIRSCSRSLE
TEEEDSPSEGGGSRKNSLKDKARWQFIIGDLLDSENDIFEQPKDCDSHGSEESQKAFDHG
TELIPWYVLSIQADVHQFLLQGATVIHYDQDTHLSARCFLQLQPDNSTLTWIKPTTASPA
STKAKLGMLSNTTEPGKFPLLGNAGLNGLAEGVLDLFSVKAVYMGHPGIDIHTVCVQNKL
SSMFLSETGVTLLYGLQTTDNRLLHFVAPKHTAKMLFSGLLELTKAVRKMRKFPDQRQQW
LRKQYVSLYQEDGRYEGPTLAHAVELFGGRRWSTRNPSPGTSAKNAEKPNVQRNNTLGIS
TTKKKKKMLMRGESGDATDDEMVTRKGKMYKECRSRSGSDPQDINEQEEPEANAISSPPN
PLPSRRAHSLTTAASPNLAAGTSSPIRPVSSPVLSSSNKSPSSAWSSSSWHGRIKGGMKG
FQSFMVSDSNMSFVEFVELFKSFSVRSRKDLKDLFDVYAVPCNRSGSESAPLYTNLTIEE
NTSDLQPDLDLLTRNVSDLGLFIKSKQQLSDNQRQISDAIAAASIVTNGTGIESTSLGIF
GVGILQLNDFLVNCQGEHCTYDDILSIIQKFEPSISMCHQGLMSFEGFARFLMDKENFAS
KNDESQENIKELQLPLSYYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDCWD
GDDGMPIIYHGHTLTTKIPFKEVVEAIDRNAFITSDLPIIISIENHCSLPQQRKMAEIFK
TVFGEKLVAKFLFETDFSDDPMLPSPDQLRRKVLLKNKKLKAHQTPVDILKQKAHQLASM
QAQAYNGGNGNPPPANNEEEEDEEDEYDYDYESLSDDNILEDRPENKSCNDKLQFEYSEE
IPKRIKKADNSACNKGKVYDMELGEEFYLPQNKKESRQIAPELSDLVIYCQAVKFPGLST
LNASGSSRGKERKSRKSIFGNNPGRMSPGETASFNKTSGKSFCEGIRQNWEETPSALNPA
TSLSALIRTPRCYHISSLNENAAKRLCRRYSQKLIQHTACQLLRTYPAATRIDSSNPSPL
MFWLHGIQLVALNYQTDDLPLHLNAAMFEANGGCGYVLKPPVLWDKSCPMYQKFSPLERD
LDNMEPAVYSLTIVSGQNVCPSNSTGSPCIEVDVLGMPLDSCHFRTKPIHRNTLNPMWNE
QFLFRVHFEDLVFLRFAVVENNSSAVTAQRIIPLKALKRGYRHLQLRNLHNEVLEISSLF
INSRRMEENPSGSALPASLMFNTEERKCLQTHRVTVHGVPGPEPFVVFTINGGTKAKQLL
QQILKMDHDTKPVATDYFLMEEKYFISKEKNECRKQPFQRAIGPEEEILQILSSWFPEEG
YVGRIVFKTQQEIPEEKTIVQDDREVILSSEEESFFVQVHDVSPEQPRTVIKAPRVSTAQ
DVIQQTLCKAKYSYSILSNPNPSDYVLLEEVVKDTGTKKSSTPKPSQRVLLDQECVFQAQ
SKWKGAGKFILKLKEQVQASREDKRKGISFASELKKFTKSTKQPRGLTSPSQLLASENIQ
NKEEKPMCGLSPGDTMDYRQ
NT seq 6903 nt   +upstreamnt  +downstreamnt
atgacttctgaggaaatggcagcttctgttactcctgcgactcagagaaaagtagtgtct
gctctgtcaacagcagaggaaagtaaggaaaaggcctccggcatcggcgttccaaaggtg
tgtaccgggaggcagagcaggcagttgcctcattccatctcacaactgaacacatttaaa
gaagactgctccaggagccatttgcccgaggttatctcaatagcaagggagaaaatagtg
agcgacgagaacagtaatgaaaggtgctgggagcagagcgtgccggagtcgatgaagaac
cttaacattagctgcagcagcttgctgagaaaccatcagcatggcctgcccccgagccag
ttttatgaaacgtgtgactctgtcaccgagcaagacttgtgtttggaaactggaattcct
tctccactggaaagaaaggtgtttcctggaattcaactggaaatagctggacctcccatg
gatattagtcctttaggaaatcatccagcggttatggagactgatggatcacaccctggc
agcaacgtggcactattgcattttcattatgaggttgacagaagaacatcagacactttc
tgtaccatggcagaaaacttaaccttggatgattgtggaaactgtgtaccactgcctcct
gttgagggggagcagaagaaaaattacatggcatacacttctcaactggcgggcttggcc
caaagctgtgataatcagaatgggcagctgccgtgtggtcattgtgacaccttgaatgaa
aaatacttgtgctttgaaggcacttgccagaaggttgacggggtatgttcaagtgatagc
tttgacaaggaggattttactgccagtccgcctgccaagacctttttgagccaatttgag
cactttcctgataattgtgaagaggtagaagatttttttaaaagcaaaaaggaacgttcc
actttgctggtcagaagattttgtaaaaatgacagggaagttaagaaatctgtatatact
gggacaagagcaattgtgagaactctgccttctggccacattgggagggtcgcttggagt
tatgttgatcaaaagagaaatgctctcttagtatctcgtgggagagtgacagaacctctt
tcttctttggagatgaggcaaggtgggagccatcatttgtcagaagccccgtggtatctg
atctaccatgcagtgagaagagaagaaacagaaaatccagttggatctcttctccggttc
ttcacaaagctcccagcctcagagacagctcatgggagggtcagcctaggtccctgcctg
aagcagtgcgtccgagacactgtgtgtgagtatcgtgccaccctgcaaaggacctccatc
tctcagtacgtcaccggttctctcctggaagcaaccacgtctttaggaacaagaagtggt
cttctcagtacttttggaggttccgctggacgaatgatgctgaaagaacgccaaccaggc
acctctatggccagttccaatgccctcccttcaagttcagctggaatcagcaaggaactg
atcgatctgcagcccctcatccagttcccagaggaagtggccagcatcttaacagagcag
gaacagaatatctaccgaaaggtcttgcctgttgactacctttgcttcttaaccagggac
ttaggcacaccagaatgccagaggtccctgccctgtctcaaagcatccatctcagcatcg
attcttacctctcagaatggagaacgcaatgccctggaagaccttgtgatgagatttaat
gaggtgagctcctgggtgacgtggctgatcctcacagcaggctccatggaggagaagcgg
gaagtcttctcttacctggtgcacgtggccaaatgctgctggaacatgggcaactacaac
gctgtcatggagttcctggctggcctcaggtcgagaaaagttttgaaaatgtggcagttc
atggagcagtcagacatggataccatgagaagcctaaaggatgccatggccctgcacgag
tcctcgcgggagtaccggaaggcggtgacgcgagctctgcatatccccggctgcagggtg
gtgcccttctgcggtgtgttcctgaaggagctctgtgaggtcctcgacggagcttccggc
ctcatgaagctttgcccacgctacaattcccaggaggagactttagagtttgtagccgac
tacagtggccaagataatttcttacaacgcgtgggacagaatggcttaaagaattcggag
aaggagtccacggtcaacagcatcttccaggtcatcagaagctgcagtcggagtctggag
acagaagaggaggacagccccagtgaaggcggtggctccaggaaaaattccttgaaggac
aaagccaggtggcagtttataattggagatttgctggattcagaaaatgatatctttgag
cagcccaaggactgtgactcgcacggatctgaggagtcgcagaaggcctttgatcatggg
acagagctcatcccatggtatgtgctgtccatccaagctgatgtgcaccagttcctgctg
cagggggccacggtcatccactacgaccaggacacacacctatctgcccgctgcttcctc
cagcttcagcctgacaatagcaccttgacctggataaagcccaccactgcctccccagcc
agcactaaagcaaaacttggtatgcttagtaacacaaccgagcctggcaaattcccgtta
ctgggcaatgctggattaaatggcctagcggagggggtcttggatctgttttcagtgaag
gctgtgtacatgggacaccctggcattgatatacacactgtgtgtgttcagaacaaactg
agtagcatgtttctgtctgagaccggtgtgacactgctctatgggcttcagaccacagac
aatagattattgcactttgtggcaccaaagcacacagctaaaatgctcttcagtggattg
ttggaactcactaaagctgtgagaaagatgaggaagttccccgaccaaagacagcagtgg
ctgcggaaacagtatgtcagcctctaccaggaggatgggcgatatgaaggcccaacattg
gctcatgctgtggagttgtttggtggcaggcggtggagtactcgaaaccccagccctggg
acatcagcaaagaatgccgagaagcctaatgtacagagaaacaacaccctgggcataagc
accaccaagaagaagaagaaaatgcttatgaggggtgagagtggagatgcaacagatgac
gaaatggtgacccgaaagggcaagatgtacaaagagtgtcgaagccgcagcggttcggat
cctcaagacattaatgaacaggaggaaccagaggcaaatgccatctccagtcctcccaac
cccctcccttccagaagagcccactctttgaccacggctgcgtcccccaacttggctgcc
gggacgtcgtctcccatcaggccagtgtcctcccctgtgctgtcttcttcaaacaagagc
ccgtccagtgcttggagcagcagcagctggcatgggcggatcaaaggaggaatgaaggga
tttcagagcttcatggtttcagacagtaacatgagttttgttgaatttgttgagctgttc
aaatcgttcagtgtaaggagccgcaaagacctgaaggatctcttcgatgtgtacgcggtg
ccctgcaaccgatctggctccgagtcggccccgctctacaccaacctgaccattgaggaa
aacactagcgacctgcagccagacctagatttgttgaccagaaatgtctcggatttggga
ttgttcattaagagtaagcagcaactgtcagacaaccagaggcagatctctgacgccatt
gctgctgcgagtatcgtgacaaatggcactgggatcgagagtacatccctgggcatattt
ggggttggaattctccagctcaacgacttcctagtgaattgccaaggagaacactgcacg
tacgatgacatcctcagcatcatccagaagttcgagcctagcatcagtatgtgtcaccaa
ggtctaatgtcatttgaaggatttgcgaggtttctgatggataaagagaattttgcctcg
aaaaatgatgagtcacaggagaacattaaagaattgcagctacccctgtcctactattac
attgagtcttcacacaatacctacctcacaggccatcagctgaaaggggagtcctcagta
gaactctacagccaggtcctcttgcaaggctgtaggagtgtagagttggactgctgggat
ggagatgatgggatgcccatcatttatcatggacatacactgacaaccaagatccccttc
aaggaagtagttgaagccattgatcgaaatgctttcatcacctctgacctgccgatcatc
atatcaattgagaaccactgttcattgcctcagcaacgaaaaatggccgagattttcaag
acagtgtttggggaaaagctggtggctaaattcttgtttgagactgacttctcagatgat
ccgatgcttccttcacctgaccagctgaggaggaaagtgcttcttaaaaacaagaagctc
aaggcccatcagacaccagtggatatcttaaagcaaaaggctcatcagttagcttccatg
caagcacaggcttataatggtgggaatggcaaccccccacctgccaataatgaagaagaa
gaagatgaagaggatgaatatgactatgactatgaatccctttcagatgacaacattctg
gaagacagacctgaaaacaagtcctgtaatgacaagcttcagtttgagtacagtgaagaa
atccccaaaaggataaagaaagcagataactcggcttgcaacaaaggaaaggtgtatgac
atggaactgggagaggaattttatcttcctcaaaataaaaaagaaagcagacagattgca
ccagagctttctgacctcgtcatctattgccaagctgtgaaatttccagggctgtcaact
ctaaatgcatctggctctagcagaggaaaagaaaggaaaagcaggaagtccatttttggc
aacaatccgggcagaatgagcccaggggagacagcatcgtttaacaaaacatctggaaaa
agtttctgtgaaggcattcgccagaactgggaggagacgccctccgctctgaaccccgcc
acgtcgctcagcgctctcattcgaactccccgatgctaccacatctcgtcgctgaacgaa
aatgccgccaaacggctgtgccgcaggtattcgcagaagctgatccagcacaccgcctgt
cagctgctcaggacctacccggccgccacccgcatcgactcctccaaccccagccccctc
atgttctggctccatgggatacagctcgtggccctcaactaccagacggacgatctccct
ttgcatttaaatgctgcgatgtttgaggcaaatggtggctgcggttatgttttgaaaccc
ccagttctgtgggacaagagctgtcccatgtaccagaagttttctccactggaaagggat
ctggacaacatggagcctgctgtctactctttaactattgtctctggtcaaaacgtgtgc
cccagtaacagcacaggaagcccgtgcattgaagtggacgtcctgggcatgcccctggac
agctgccatttccgcacgaagcccatccaccgaaacaccctgaaccccatgtggaacgaa
cagtttctgttccgggttcactttgaagaccttgtgtttcttcgtttcgcagttgtggaa
aacaacagttcagcagtaaccgcccagagaatcattccactcaaggctttaaaaagagga
tatcgacatcttcagctgcgaaacctccacaatgaagtcttggaaatctccagtttattc
ataaacagcagaaggatggaagaaaatccctcaggcagtgccttgccagcctctttgatg
tttaacacagaagaaagaaaatgtttgcagactcacagagtcacggtacatggggtccca
ggcccagagccctttgtggtttttactataaatggaggcaccaaggcaaaacagcttctc
cagcaaattctgaaaatggaccatgacaccaaacctgttgccacagactattttttgatg
gaagagaagtattttatatctaaagaaaagaatgagtgcaggaagcagcctttccagaga
gccattggcccagaagaagagatcctgcagatcctgagcagctggttcccagaagaaggc
tatgtgggcaggatcgtcttcaaaactcagcaggaaatcccagaagagaaaaccattgtt
caagatgacagagaggtgatcttgagctcagaggaagagagcttctttgtccaggtgcat
gacgtttccccagagcagccacggacagtcatcaaggcaccccgtgtcagcactgcacag
gacgtcattcagcagaccttgtgcaaagccaaatattcctacagcatcctgagcaatccc
aacccaagtgactacgtgcttctggaagaggtggtgaaagacactggcaccaagaagtct
tctaccccaaagccctctcagcgagtccttttggatcaggagtgtgtgtttcaagcccaa
agcaagtggaaaggtgcgggaaaattcatccttaagctaaaggaacaggtgcaggcttcc
cgagaagataaaagaaaaggcatttcttttgccagtgaactcaaaaagttcaccaagtca
actaaacagcctcgaggactcacatcaccttctcagctcttagcctcagaaaacatccaa
aacaaggaggagaaacccatgtgtggtttgtcccctggagacacaatggattatcggcag
tga

DBGET integrated database retrieval system