KEGG   Oryctolagus cuniculus (rabbit): 100344574
Entry
100344574         CDS       T03373                                 

Gene name
PELO
Definition
(RefSeq) pelota homolog (Drosophila)
  KO
K06965  protein pelota
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100344574 (PELO)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100344574 (PELO)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     100344574 (PELO)
SSDB
Motif
Pfam: eRF1_1 eRF1_2 eRF1_3
Other DBs
NCBI-GeneID: 100344574
NCBI-ProteinID: XP_002714073
Ensembl: ENSOCUG00000023902
UniProt: G1TVY8
LinkDB
Position
11
AA seq 385 aa
MKLVRKDIEKDNAGQVTLVPEEPEDMWHTYNLVQVGDSLRASTIRKVQTESSTGSVGSNR
VRTTLTLCVEAIDFDSQACQLRVKGTNIQENEYVKMGAYHTIELEPNRQFTLAKKQWDSV
VLERIEQACDPAWSADVAAVVMQEGLAHICLVTPSMTLTRAKVEVNIPRKRKGNCSQHDR
ALERFYEQVVQAIQRHIHFDVVKCILVASPGFVREQFCDYMFQQAVKTDNKVLLENRSKF
LQVHASSGHKYSLKEALCDPTVASRLSDTKAAGEVKALDDFYKMLQHEPDRAFYGLKQVE
KANEAMAIDTLLISDELFRHQDVATRSRYVKLVDSVKENAGTVRIFSSLHVSGEQLSQLT
GVAAILRFPVAELSDQEDNSSSEED
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgaagctcgtgaggaaggacattgagaaggacaacgcgggccaggtgaccctggtcccc
gaggagcccgaggacatgtggcacacgtacaacctagtgcaggtgggcgacagcttgcgc
gcctccaccatccgcaaggtgcagaccgagtcctccacgggcagcgtgggcagcaaccgg
gtgcgcaccaccctcactctgtgcgtggaggccatcgacttcgactcccaagcctgccag
ctgcgggtcaaggggaccaacatccaagagaacgagtacgtcaagatgggggcttaccac
accatcgagctggagcccaaccgccagttcaccctggccaagaagcagtgggacagcgtg
gttctggagcgcatcgagcaggcctgcgaccctgcctggagcgctgatgtggcggccgtg
gtcatgcaggaaggcctcgcccacatctgcttagtcactcccagcatgaccctcacccgg
gccaaggtggaggtgaacatccccaggaagaggaaaggcaactgctcgcagcacgaccgg
gccttggagcggttctacgagcaggtggtgcaggccatccagcgccacatacactttgac
gtcgtcaagtgcatcctggtggccagcccggggttcgtgagggagcaattctgcgactac
atgtttcagcaagcagtgaagactgacaacaaagtgctcctcgaaaaccggtccaaattc
cttcaggtacatgcctcctctggacacaagtactccttgaaagaggccctttgtgaccct
accgtagccagccgcctttcagacactaaagctgctggggaagtaaaagccctggatgac
ttttataaaatgttacagcacgaacctgaccgagccttctatggactcaagcaggtggag
aaggccaacgaagccatggcaatcgacacgttgctcatcagcgatgagctcttcaggcac
caggatgtagccacgcggagccggtatgtgaagctggtggacagtgtgaaggagaacgca
ggcacggtcaggatattctccagtcttcatgtgtctggggagcagctcagccagctgact
ggagtagcggccattcttcgcttccctgtggctgagctctccgaccaagaggataactcc
agttctgaagaggattga

DBGET integrated database retrieval system