KEGG   Oryctolagus cuniculus (rabbit): 100344727Help
Entry
100344727         CDS       T03373                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00250  Alanine, aspartate and glutamate metabolism
ocu00410  beta-Alanine metabolism
ocu00430  Taurine and hypotaurine metabolism
ocu00650  Butanoate metabolism
ocu01100  Metabolic pathways
ocu04727  GABAergic synapse
ocu04940  Type I diabetes mellitus
Module
ocu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ocu00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    100344727 (GAD1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100344727 (GAD1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100344727 (GAD1)
   00430 Taurine and hypotaurine metabolism
    100344727 (GAD1)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    100344727 (GAD1)
 Human Diseases
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    100344727 (GAD1)
Enzymes [BR:ocu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     100344727 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase OKR_DC_1 SepSecS DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 100344727
NCBI-ProteinID: XP_002712323
Ensembl: ENSOCUG00000012644
UniProt: G1T3T2
LinkDB All DBs
Position
7
AA seq 594 aa AA seqDB search
MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEK
SRLVSAFRERQSSKNLLSCENSDREARFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEV
VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWS
SKDGDGIFSPGGAISNLYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAA
LGFGTDNVILIKCNERGKIIPADLEAKILESKQKGYVPLYVNATAGTTVYGAFDPIQEIA
DLCEKYNLWLHVDAAWGGGLLMSRKHRHKLSGIERANSVTWNPHKMMGVLLQCSAILVRE
KGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQI
NKCLELAEYLYAKIKNREEFEMVFDGEPEHTNVCFWYIPPSLRGVPDSPERREKLHRVAP
KIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttcgacaccttcttcgtccgcaacctcctcgaacgcgggagcggaccccaac
accaccaacctgcgccccacaacgtacgacacctggtgcggcgtggcccacggatgcacc
cgaaaactggggctgaagatctgcgggtttttgcaaaggaccaacagcctggaagagaag
agccgcctcgtgagcgccttccgggagaggcagtcctccaagaatctgctctcctgcgag
aacagcgacagggaggcccgcttccggcgcaccgagaccgacttctccaacttgttcgct
cgagatctgcttccagctaagaacggagaagagcagaccgtgcagttcctgctggaggtg
gtggacatcctgctcaactatgtccgtaagacgtttgaccggtccaccaaggtgctggac
ttccatcacccacaccagttgctggaaggcatggagggcttcaacctggagctctccgac
catcccgagtccctggagcagatcctggttgactgcagagacaccctgaagtatggcgtc
cgcacaggtcatcctcgatttttcaaccagctctccactggattggatatcattggctta
gcaggcgaatggctgacatcaactgccaacactaatatgtttacctatgaaattgcacca
gtgtttgtcctcatggagcagataacactgaagaagatgagagagatagttggctggtcg
agtaaagatggtgatgggatattttctcctgggggagccatttccaacctgtacagcatc
atggctgcccgctacaagtactttccggaagttaagacaaagggcatggccgccgtgccc
aaactggtcctcttcacctcagaacatagtcactattccatcaagaaagctggggctgcg
cttggctttggaaccgacaatgtgattttgataaagtgcaatgaaagggggaagataatc
ccggctgatttagaggcaaaaattcttgaatccaagcaaaaggggtatgttcctctttat
gtcaacgcgacggccggcacgactgtttatggagcttttgacccgatacaggagattgca
gatctgtgtgagaagtacaacctctggctgcacgtcgacgccgcgtggggcggggggctg
ctcatgtcgaggaagcaccgccataaactcagcggcatcgaaagagccaactcggtcacc
tggaaccctcacaagatgatgggcgtgctgttgcagtgctcggccattctcgtccgggag
aaggggatactccaaggatgcaaccagatgtgtgcaggatacctcttccagccagacaag
cagtacgatgtctcctacgacaccggggacaaggcgattcagtgtggccgccacgtggac
atcttcaagttctggctgatgtggaaagcaaagggcactgtgggatttgaaaatcagatt
aacaaatgcctggaactggctgagtacctctatgccaagattaaaaacagagaagagttt
gagatggtgtttgatggcgagcctgaacacaccaacgtctgtttctggtatattccaccg
agcctcaggggcgttcccgacagccctgagcggcgggagaaactccacagggtggctccc
aaaatcaaagctctgatgatggagtcgggcaccaccatggttggctaccagcctcagggg
gacaaggccaacttcttccggatggtcatttcgaacccagctgctacccagtctgacatc
gacttcctcattgaggagatagaaagactgggccaggatctgtaa

DBGET integrated database retrieval system