KEGG   Oryctolagus cuniculus (rabbit): 100344825
Entry
100344825         CDS       T03373                                 

Gene name
DCC
Definition
(RefSeq) DCC netrin 1 receptor
  KO
K06765  deleted in colorectal carcinoma
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100344825 (DCC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100344825 (DCC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100344825 (DCC)
SSDB
Motif
Pfam: Neogenin_C fn3 I-set Ig_3 Ig_2 ig V-set Pur_ac_phosph_N C2-set_2 Interfer-bind Ig_4 Ig_6 EphA2_TM Protocadherin V-set_CD47 FAM176 CD34_antigen Ly49 TMEM154
Other DBs
NCBI-GeneID: 100344825
NCBI-ProteinID: XP_017199772
Ensembl: ENSOCUG00000000384
LinkDB
Position
9
AA seq 1433 aa
MENSLGCVWVPKLAFVLFGASLLSAHLQVTGFQIKAFTSLRFLSEPSDAVTMRGGSVLLN
CSAESDRGVPVIKWRKDGIHLALGLEERKQQLPNGSLLIQNILHSRHHKPDEGLYQCEAS
LGDSGSIISRTAKVAVAGPLRFLSQTESVTAFMGDTVLLKCEVIGEPMPTIHWQKNQQDL
TPVPGDSRVVVLPSGALQISRLQPGDIGIYRCTARNPASSRTGNEAEVRILSDPGLHRQL
YFLQRPSNVVAVEGQEAVLECCVSGYPPPSFTWLRGEEVIQLRSKKYSLLGGSNLLISNV
TDDDSGTYTCVVTYKNENISASAELTVLVPPWFLNHPSNLYAYESMDIEFECAVSGKPVP
TVNWMKNGDVVIPSDYFQIVGGSNLRILGVVKSDEGFYQCVAENEAGNAQSSAQLIVPKL
AIPSSSVLPSAPRDVVPVLVSSRFVRLSWRPPAEAKGNVQTFTVFFSREGDNRERALNTT
QPGSLQLTVGNLKPEAMYTFRVVAYNEWGPGESSQPIKVATQPELQVPGPVENLQAVSTS
PTSILITWEPPAYANGPVQGYRLFCTEVSTGKEQNIEVDGLSYKLEGLKKFTEYSLRFLA
YNRYGPGVSTDDITVVTLSDVPSAPPQXVSLEVVNSRSIKVSWLPPPSGTQNGFITGYKI
RHRKTTRRGEMETLEPNNLWYLFPGLEKGSQYSFQVSAMTVNGTGPPSNWYTAETPENDL
DESQVPDQPSSLHVRPQTNCIIMSWTPPLNPNIVVRGYIIGYGVGSPYAETVRVDSKQRY
YSIERLESSSHYVISLKAFNNAGEGVPLYESATTRSITDPTDPVDYYPLLDDFPTSVPDV
STPMLPPVGVQAVALTHEAVRVSWADNSVSKNQKTSDVRLYTVRWRTSFSASAKYKSEDT
TSLSYTATGLKPNTMYEFSVMVTKNRRSSTWSMTAHATTYEAAPTSAPKDLTVITREGKP
RAVIVSWQPPLEANGKITAYILFYTLDKNIPIDDWIMETISGDRLTHQIMDLNLDTMYYF
RIQARNAKGVGPLSDPILFRTLKVEHPDKMANDQGRHGDGGYWPVDTNLIDRSTLNEPPI
GQMHPPHGSVTPQKNSNLLVIIVVTVGVITVLVVVIVAVICTRRSSAQQRKKRATHSVGK
RKGSQKELRPPDLWIHHEEMEMKNMEKPSGTDPAGRDSPSQSCQDLTPVSHSQSETQLGS
KSTSHSGQDTEEAGSSMSILESHWLLASYTGSVVSAIPVPTLESAQYPGILPSPTCGYPH
PQFTLRPVPFPTLSVDRGFGAGRTQSISEGPTTQQPPMLPPAQPEHPSSEEAPSRTIPTA
CVRPTHPLRSFANPLLPPPMSAIEPKVPYTPLLSQPGPTLPKTHVKTASLGLAGKARSPL
LPVSVPTAPEVSEESHKPTEDPANVYEQDDLSEQMASLEGLMKQLNAITGSAF
NT seq 4302 nt   +upstreamnt  +downstreamnt
atggagaatagtcttggatgtgtttgggtacccaagctggcttttgtactcttcggagct
tccctgctcagcgcgcatcttcaagtcaccggtttccaaattaaagccttcacatccctg
cgcttcctgtcggaaccctctgatgccgtcacgatgcggggaggaagcgtcctcctgaac
tgctctgcggagtcggaccgcggagtgccggtcatcaagtggaggaaagacggcatccac
ctcgccctggggctggaggagaggaagcagcagcttcccaatgggtctctactgatacag
aacatcctccattccagacaccacaagccagacgagggactttatcaatgtgaggcgtct
ctgggagattccgggtcaattatcagtcggacagcgaaagttgcagtagcaggaccattg
aggttcctttcccagacagaatccgtcacagccttcatgggagatacagtgctacttaag
tgtgaagtcatcggggagcccatgccaacaatacattggcagaagaaccagcaagacctg
actccagtcccaggggactctagggtggtggtcttgccctctggagcattgcaaatcagc
agacttcaaccaggggacattggaatctatcgatgcacagctcggaatccagccagctcc
agaacaggaaatgaagcagaagtcagaattttatcagatccgggactgcacaggcagctg
tattttctacagagaccctccaatgtagtagccgttgaaggacaagaggcggtcctggag
tgctgcgtttctggctatcctccgccaagttttacctggttacgaggcgaggaagtcatc
caactcaggtctaaaaagtattctttattgggtggaagtaacttgcttatctccaacgtg
acagatgatgacagtggaacttacacctgtgttgtcacgtataaaaatgagaacattagt
gcctctgcagagctcacagtcctggttccaccctggtttttaaatcacccttccaacctc
tatgcctatgaaagcatggacattgagtttgaatgtgcagtctctggaaagcctgtgccc
actgtgaattggatgaagaatggagatgtggtcattcctagtgattattttcagatagtg
ggaggaagcaatttacggattcttggagtggtgaagtcagatgaaggcttttatcaatgt
gtggctgaaaatgaagctggaaatgcccagagcagtgcacagcttatcgtccctaagctt
gctatcccaagctccagtgtcctcccttctgctcccagagatgtggtccctgtcttagtt
tccagtcggtttgtccgtctcagctggcgcccacctgcagaagcaaaagggaatgttcaa
accttcacagtctttttctccagagaaggtgacaacagggagcgagcactgaatacaacc
cagcctgggtccctacagcttactgtgggcaacctgaagccagaagccatgtacacgttc
cgagtagtggcctacaacgagtggggtccaggggagagttcccaacccatcaaggtggct
acccagcctgaattgcaagtgccagggccagtagaaaacctgcaagctgtatctacctca
cctacctcaattcttattacctgggaaccccctgcctatgcaaatggtccagtccaagga
tacagattgttctgcactgaagtgtccacaggcaaagaacagaatatagaggttgatgga
ctctcttataaactggaaggcctgaagaaattcacggagtatagtcttcgattcctagct
tataatcgctatgggccaggtgtatctactgatgatataacagtggttacgctctctgat
gtgccaagtgctccacctcagnacgtctcgctggaagtggtgaattcgaggagcatcaaa
gtaagctggctgcctcctccatcaggaacacaaaatggattcattactggctataaaatt
cgacatagaaagacgacccgcaggggtgagatggaaacactggagccaaacaacctctgg
tacctgttcccaggactggagaagggcagtcagtacagcttccaagtgtcagccatgaca
gtcaacggcactggacccccctccaactggtatacagcagagaccccagagaatgatctg
gacgaatctcaagtccctgatcagccaagctctcttcatgtgagacctcagaccaactgc
ataatcatgagttggacacctcccttgaacccaaacattgtagtgagaggttacattatt
ggatacggtgttgggagcccttatgcagagaccgtgcgcgtggacagtaagcagcggtat
tattccattgagagattagagtcaagttcccattacgtaatctccctaaaagcttttaac
aatgcaggagaaggagttcctctttatgaaagtgccactaccagatccataacagatccc
actgacccagttgattattatcctttgcttgacgatttccccacctccgtcccagatgtc
tccacccccatgctcccaccagtaggtgtacaggctgtggctctcacccacgaggctgtg
agggtcagctgggcagacaactctgtctctaagaaccaaaagacttccgacgtgcggctt
tacactgtccggtggaggaccagtttttctgccagtgccaaatacaagtcagaagacaca
acatctctaagttacacagcaacaggcctcaagccaaacacaatgtatgagttctcagtc
atggtaacaaagaacagacgatcaagcacatggagcatgacagcacatgccaccacatat
gaagcagccccgacctctgctcccaaggatttgacagtcattacccgggaagggaagcct
cgagctgtcattgtgagctggcagcctccattggaagccaatggaaaaatcactgcttac
attttattttataccttggacaagaatataccaatcgatgactggattatggaaacaatc
agtggtgatcggctcactcatcagatcatggatctcaacctcgacaccatgtactatttc
cgaattcaagcacggaatgcgaaaggagtggggcccctctctgacccaattcttttcagg
actctgaaagtggaacaccctgacaaaatggctaatgaccaaggtcgtcatggagatggg
ggttattggccagtagatactaatttgattgataggagcactctcaatgagccacccatt
ggacagatgcaccccccacacggcagtgtcaccccacagaagaacagcaacctgcttgtg
atcatcgtggtcactgtcggtgtcatcacagtgctggtcgtggtgattgtggccgtgatt
tgcactcggcgctcttcagctcagcagagaaagaaacgggccacccacagtgttggcaaa
aggaaaggcagccagaaggagctccgacctcctgatctttggatccatcatgaagaaatg
gagatgaaaaacatggagaagccctcaggcactgaccctgcgggaagagattccccctcc
caaagttgccaagacctcacaccagtcagccacagccagtcagaaacccaactggggagc
aaaagcacctctcattcaggtcaagacactgaggaagcaggcagctccatgtccatcctg
gagagtcactggctgctcgcgagctacacgggctctgttgtgagtgccatccctgtacca
accctagaaagtgcccagtacccaggaatcctcccatctcccacctgtggatatccccac
ccgcagttcactctccggcccgtgccattcccaacactgtcagtggaccgaggattcgga
gcaggaagaactcagtcaataagtgaaggaccaaccacccagcaaccacccatgctaccc
ccagctcagcccgagcatcccagcagtgaggaggcaccaagcagaaccatccccacggcc
tgtgttcgaccgacgcatccactccgcagctttgctaaccctctgctacctccgccaatg
agtgcaatagaaccgaaagtcccttacacaccacttttgtctcagccagggcctactctt
cccaagacccacgttaaaacagcctctcttggattggctggaaaagctagatcccctttg
cttcctgtgtctgtgccaacagcccctgaagtgtctgaggagagccacaaaccaacagag
gatccagctaatgtctatgagcaggatgatttgagtgaacaaatggcaagtttagaaggg
ctaatgaagcaacttaatgccatcacaggctcagccttttaa

DBGET integrated database retrieval system