KEGG   Oryctolagus cuniculus (rabbit): 100345444
Entry
100345444         CDS       T03373                                 

Gene name
RASSF5
Definition
(RefSeq) Ras association domain family member 5
  KO
K08015  Ras association domain-containing protein 5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04218  Cellular senescence
ocu04670  Leukocyte transendothelial migration
ocu05200  Pathways in cancer
ocu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100345444 (RASSF5)
   04015 Rap1 signaling pathway
    100345444 (RASSF5)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100345444 (RASSF5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100345444 (RASSF5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100345444 (RASSF5)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    100345444 (RASSF5)
SSDB
Motif
Pfam: Nore1-SARAH RA
Other DBs
NCBI-GeneID: 100345444
NCBI-ProteinID: XP_002717596
Ensembl: ENSOCUG00000015444
UniProt: G1T9F7
LinkDB
Position
16
AA seq 261 aa
MTVDRSMSSLDEELEDCFFTAKTTFFRNVQSRSPSKNVCKPSVEPQRPPTLQEIKQKIDS
YNAREKNCLGMKLSEDGTYTGFIKVHLKLRRPVTVPAGIRPQSIYDAIKEVNLAATTDKR
TSFYLPLDAIKQLHISSTTTVSEVIQGLLKKFMVVDNPQKFALFKRTHKDGQVLFQKLSI
ADCPLHLRLLAGPDTDVLSFVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIQQVQR
KYGKFRRQLEAALRESQGKPG
NT seq 786 nt   +upstreamnt  +downstreamnt
atgaccgtggaccgcagcatgagcagcctggacgaggagctagaagactgcttcttcaca
gccaagaccacctttttcaggaatgtgcagagcaggtctccctccaagaatgtctgcaag
ccctcggtggagccgcagcgcccacccacgctgcaggagatcaagcagaagatcgacagc
tacaacgcgcgggagaagaactgcctgggcatgaagctgagtgaagacggcacctacacc
ggcttcatcaaagtgcacttgaaactgcggcggcccgtgacggtgcctgccgggatccgg
ccccagtccatctacgatgccatcaaggaggtgaacctggctgccaccacggacaagcgg
acgtccttctacctgccgctcgacgccatcaagcagctgcacatcagcagcaccaccacg
gtcagcgaggtcatccaggggctgctcaagaagttcatggtcgtggacaatccccagaag
tttgccctttttaagcggacccacaaggacggacaagtgctcttccagaaactgtccatt
gccgactgccccctccatctgcgcctccttgctgggcccgacaccgacgtcctcagcttc
gtgctcaaagagaatgaaactggagaggtggagtgggacgccttctccatccctgagctc
cagaacttcctcacaatcctggagaaggaggagcaggacaaaatccagcaggtgcagagg
aagtacggcaagtttagacgacagctggaggcggccctaagggaatcccagggcaagcct
gggtaa

DBGET integrated database retrieval system