Oryctolagus cuniculus (rabbit): 100345483 Help Entry 100345483         CDS       T03373                                  Gene name BCL2L11 Definition (RefSeq) BCL2 like 11   KO K16341   Bcl-2-like protein 11 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu01521   EGFR tyrosine kinase inhibitor resistance ocu04068   FoxO signaling pathway ocu04151   PI3K-Akt signaling pathway ocu04210   Apoptosis ocu04215   Apoptosis - multiple species ocu04932   Non-alcoholic fatty liver disease ocu05169   Epstein-Barr virus infection ocu05200   Pathways in cancer ocu05206   MicroRNAs in cancer ocu05210   Colorectal cancer Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     100345483 (BCL2L11)    04151 PI3K-Akt signaling pathway     100345483 (BCL2L11)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     100345483 (BCL2L11)    04215 Apoptosis - multiple species     100345483 (BCL2L11)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100345483 (BCL2L11)    05206 MicroRNAs in cancer     100345483 (BCL2L11)   09162 Cancer: specific types    05210 Colorectal cancer     100345483 (BCL2L11)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100345483 (BCL2L11)   09172 Infectious disease: viral    05169 Epstein-Barr virus infection     100345483 (BCL2L11)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100345483 (BCL2L11) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bim_N Bclx_interact PMAIP1 G_path_suppress Motif Other DBs NCBI-GeneID:  100345483 NCBI-ProteinID:  XP_017195550 LinkDB All DBs Position 2 AA seq 140 aa AA seqDB search MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQSEPQDRSPAPMSCDKSTQTPSPP CQAFNHYLSAMASMRQSQAEPADTRPETWIAQELRRIGDEFNAYYPRRVFLNNYPAAEEQ PQMVILRLLRYIVRLVWRMH NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccaagcaaccttccgatgtaagttctgagtgtgacagagaaggtggacagttgcag cctgcggagaggccgccccagctcaggcctggggcccccacctccctgcagtcggagccg caagacaggagcccggcacccatgagctgtgacaaatcaacacaaaccccaagtcctcct tgccaggccttcaaccactatctcagtgcaatggcttccatgaggcagtctcaggctgaa cctgcagacacgcgtccggagacctggatcgcgcaggagttgcggcggatcggagacgag ttcaacgcgtattacccacgcagggtttttttgaataattacccagcagcggaggagcag ccccaaatggttatcttgcgactgttgcgttacatcgtgcgcctggtgtggaggatgcat tga

DBGET integrated database retrieval system