KEGG   Oryctolagus cuniculus (rabbit): 100345483
Entry
100345483         CDS       T03373                                 

Gene name
BCL2L11
Definition
(RefSeq) BCL2 like 11
  KO
K16341  Bcl-2-like protein 11
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu04068  FoxO signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04210  Apoptosis
ocu04215  Apoptosis - multiple species
ocu04932  Non-alcoholic fatty liver disease
ocu05169  Epstein-Barr virus infection
ocu05200  Pathways in cancer
ocu05206  MicroRNAs in cancer
ocu05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100345483 (BCL2L11)
   04151 PI3K-Akt signaling pathway
    100345483 (BCL2L11)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100345483 (BCL2L11)
   04215 Apoptosis - multiple species
    100345483 (BCL2L11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100345483 (BCL2L11)
   05206 MicroRNAs in cancer
    100345483 (BCL2L11)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100345483 (BCL2L11)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100345483 (BCL2L11)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100345483 (BCL2L11)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100345483 (BCL2L11)
SSDB
Motif
Pfam: Bim_N Bclx_interact PMAIP1 G_path_suppress
Other DBs
NCBI-GeneID: 100345483
NCBI-ProteinID: XP_017195550
LinkDB
Position
2
AA seq 140 aa
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQSEPQDRSPAPMSCDKSTQTPSPP
CQAFNHYLSAMASMRQSQAEPADTRPETWIAQELRRIGDEFNAYYPRRVFLNNYPAAEEQ
PQMVILRLLRYIVRLVWRMH
NT seq 423 nt   +upstreamnt  +downstreamnt
atggccaagcaaccttccgatgtaagttctgagtgtgacagagaaggtggacagttgcag
cctgcggagaggccgccccagctcaggcctggggcccccacctccctgcagtcggagccg
caagacaggagcccggcacccatgagctgtgacaaatcaacacaaaccccaagtcctcct
tgccaggccttcaaccactatctcagtgcaatggcttccatgaggcagtctcaggctgaa
cctgcagacacgcgtccggagacctggatcgcgcaggagttgcggcggatcggagacgag
ttcaacgcgtattacccacgcagggtttttttgaataattacccagcagcggaggagcag
ccccaaatggttatcttgcgactgttgcgttacatcgtgcgcctggtgtggaggatgcat
tga

DBGET integrated database retrieval system