KEGG   Oryctolagus cuniculus (rabbit): 100346106
Entry
100346106         CDS       T03373                                 

Gene name
TNFRSF1A
Definition
(RefSeq) TNF receptor superfamily member 1A
  KO
K03158  tumor necrosis factor receptor superfamily member 1A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04064  NF-kappa B signaling pathway
ocu04071  Sphingolipid signaling pathway
ocu04150  mTOR signaling pathway
ocu04210  Apoptosis
ocu04215  Apoptosis - multiple species
ocu04217  Necroptosis
ocu04380  Osteoclast differentiation
ocu04668  TNF signaling pathway
ocu04920  Adipocytokine signaling pathway
ocu04931  Insulin resistance
ocu04932  Non-alcoholic fatty liver disease
ocu05010  Alzheimer disease
ocu05014  Amyotrophic lateral sclerosis
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05132  Salmonella infection
ocu05142  Chagas disease
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100346106 (TNFRSF1A)
   04064 NF-kappa B signaling pathway
    100346106 (TNFRSF1A)
   04668 TNF signaling pathway
    100346106 (TNFRSF1A)
   04071 Sphingolipid signaling pathway
    100346106 (TNFRSF1A)
   04150 mTOR signaling pathway
    100346106 (TNFRSF1A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100346106 (TNFRSF1A)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100346106 (TNFRSF1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100346106 (TNFRSF1A)
   04215 Apoptosis - multiple species
    100346106 (TNFRSF1A)
   04217 Necroptosis
    100346106 (TNFRSF1A)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100346106 (TNFRSF1A)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100346106 (TNFRSF1A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100346106 (TNFRSF1A)
   05014 Amyotrophic lateral sclerosis
    100346106 (TNFRSF1A)
   05022 Pathways of neurodegeneration - multiple diseases
    100346106 (TNFRSF1A)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100346106 (TNFRSF1A)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100346106 (TNFRSF1A)
   04931 Insulin resistance
    100346106 (TNFRSF1A)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100346106 (TNFRSF1A)
   05152 Tuberculosis
    100346106 (TNFRSF1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100346106 (TNFRSF1A)
   05170 Human immunodeficiency virus 1 infection
    100346106 (TNFRSF1A)
   05164 Influenza A
    100346106 (TNFRSF1A)
   05160 Hepatitis C
    100346106 (TNFRSF1A)
   05168 Herpes simplex virus 1 infection
    100346106 (TNFRSF1A)
   05163 Human cytomegalovirus infection
    100346106 (TNFRSF1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100346106 (TNFRSF1A)
   05165 Human papillomavirus infection
    100346106 (TNFRSF1A)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100346106 (TNFRSF1A)
   05142 Chagas disease
    100346106 (TNFRSF1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100346106 (TNFRSF1A)
   04090 CD molecules [BR:ocu04090]
    100346106 (TNFRSF1A)
Cytokine receptors [BR:ocu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100346106 (TNFRSF1A)
CD molecules [BR:ocu04090]
 Proteins
  100346106 (TNFRSF1A)
SSDB
Motif
Pfam: TNFR_c6 Death DUF4880
Other DBs
NCBI-GeneID: 100346106
NCBI-ProteinID: XP_002712881
Ensembl: ENSOCUG00000010146
UniProt: G1SYP2
LinkDB
Position
8
AA seq 461 aa
MGLPTVPGLLLPLVLLALLEIHPLGVAGLVPHLGDWEKGETVCPQGKYNHSQNKSICCTK
CHKGTYLYNDCPGPGLDSDCRKCENGTFTASENHLTQCLSCSKCRKERNQVEISSCTVDH
DTVCGCRKNQYRRYWAKTQFQCSNCSLCLNGTVIIPCQESQDTVCDCHAGFFLRENQCVP
CSNCKENPVCMKLCLPPTGNVQGSQDSGATVLLPLVIFFGLCLLSLLFTVLMCHYQRRWK
PKFYSIVCGKATPVKEGELEGLPAKPLAPAPGVCPPPGFSPIPGFSPDLGICTNSTSTFP
REDWPSFRAMPPSRGVALAYREAEPVHTTALASTPILTPLQKWEDCSAPAAVAPQQRPDT
DPVTLYAVVDGVPPSRWREFVRRLGLREHEIERLELQNGRCLREAQYSMLAAWRQRTPRH
EATLDLLGSVLRDMDLLGCLEDIEAVLGGPASQPSEARLPR
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgggcctccccaccgtgcctggcctgctgctgccactggtgctcctggctctgttggaa
atacaccccctaggggttgctggactggtccctcaccttggggactgggagaagggagag
actgtgtgtccccagggaaaatacaaccactctcaaaataagtccatctgctgcaccaag
tgccacaaaggaacctacttgtacaatgactgtcctggcccaggcctggactcggactgc
aggaagtgtgaaaacggcacctttaccgcctcggagaaccacctcacccagtgcctcagc
tgctccaaatgccggaaggagaggaatcaggtggagatttcttcttgcacagtggaccat
gacaccgtgtgtggctgcaggaagaaccagtaccggcgttactgggcaaaaacccagttc
cagtgctccaactgcagcctttgcctcaacggcaccgtgatcatcccctgccaggagagt
caggacaccgtgtgtgactgccatgcaggcttcttcctaagagaaaaccagtgcgtcccc
tgtagtaattgtaaggagaacccagtgtgcatgaaactgtgcctgcccccgaccgggaac
gtccagggctctcaggactcaggcgccacagtgctgctgcccctggtgatcttctttggt
ctgtgcctgctctccctgctcttcactgttttaatgtgccactaccagcggcggtggaag
cccaagttctactccattgtttgtgggaaagcgacacctgtcaaagagggggagcttgaa
ggtcttcctgccaaacccctcgcccctgccccaggagtctgcccgcctccaggcttcagc
cccatccccggcttcagccccgacctgggcatctgtaccaactccacttccacctttccc
cgtgaggactggcccagcttcagggctatgccgccctccagaggggtggccctggcctac
cgggaggctgagcccgtccacaccacggccctggcctccacacccatcctcaccccgctt
cagaagtgggaggactgcagcgcccccgcggcggtggccccgcagcagcgccccgacacc
gaccccgtgacgctgtatgccgtggtggacggcgtgcccccatctcgctggcgggagttt
gtgcggcgcctggggctccgcgagcacgagatagagcggctggagctgcagaacgggcgc
tgcctgcgcgaggcccagtacagcatgctggcggcctggcggcagcgcacgccgcgccac
gaagccacgctggacctgctgggcagcgtgctccgcgacatggacctgctcggctgcctg
gaggacatcgaggcggtgctgggcggccccgcctcccagccctcggaggcccgccttccg
cggtga

DBGET integrated database retrieval system