KEGG   Oryctolagus cuniculus (rabbit): 100346303
Entry
100346303         CDS       T03373                                 

Gene name
SMAD3
Definition
(RefSeq) SMAD family member 3
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04068  FoxO signaling pathway
ocu04110  Cell cycle
ocu04144  Endocytosis
ocu04218  Cellular senescence
ocu04310  Wnt signaling pathway
ocu04350  TGF-beta signaling pathway
ocu04371  Apelin signaling pathway
ocu04390  Hippo signaling pathway
ocu04520  Adherens junction
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04659  Th17 cell differentiation
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu05161  Hepatitis B
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
ocu05212  Pancreatic cancer
ocu05220  Chronic myeloid leukemia
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100346303 (SMAD3)
   04350 TGF-beta signaling pathway
    100346303 (SMAD3)
   04390 Hippo signaling pathway
    100346303 (SMAD3)
   04371 Apelin signaling pathway
    100346303 (SMAD3)
   04068 FoxO signaling pathway
    100346303 (SMAD3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100346303 (SMAD3)
  09143 Cell growth and death
   04110 Cell cycle
    100346303 (SMAD3)
   04218 Cellular senescence
    100346303 (SMAD3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100346303 (SMAD3)
   04550 Signaling pathways regulating pluripotency of stem cells
    100346303 (SMAD3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100346303 (SMAD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100346303 (SMAD3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100346303 (SMAD3)
   05212 Pancreatic cancer
    100346303 (SMAD3)
   05225 Hepatocellular carcinoma
    100346303 (SMAD3)
   05226 Gastric cancer
    100346303 (SMAD3)
   05220 Chronic myeloid leukemia
    100346303 (SMAD3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100346303 (SMAD3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100346303 (SMAD3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100346303 (SMAD3)
   05161 Hepatitis B
    100346303 (SMAD3)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 100346303
NCBI-ProteinID: XP_002718222
LinkDB
Position
17
AA seq 425 aa
MSSILPFTPPIVKRLLCWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNV
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETP
PPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYEL
NQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR
CSSVS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgtcgtccatcctgcccttcaccccgccgatcgtgaagcgcctgctgtgctggaagaag
ggtgagcagaacgggcaggaggagaagtggtgtgagaaggcggtcaagagcctggttaag
aagctcaagaagacggggcagctggacgagctggagaaggccatcaccacgcagaacgtc
aacaccaagtgcatcaccatccccaggtccctggatggccggctgcaggtgtcccatcgg
aaggggctccctcatgtcatctactgccgcctgtggcgatggccagacctgcacagccac
cacgagctgcgggccatggagctctgtgagtttgccttcaacatgaagaaggatgaggtt
tgcgtgaatccctaccactatcagagagtggagacgccagttctacctcctgtgctggtg
ccacgccacacggagatcccggccgagttccccccgctggacgactacagccattccatc
cccgagaacaccaacttccccgcgggcatcgagccccagagcaatattccagagaccccg
cccccaggctacctgagcgaagatggagagaccagcgaccaccagatgaaccacagcatg
gacgcaggttctccaaacctgtccccgaatccgatgtccccagcacacaataacttggac
ctgcagcccgtcacctactgcgagccggcattctggtgctccatctcctactacgagctg
aaccagcgcgtcggggagaccttccacgcctcgcagccctccatgaccgtggacggcttc
accgacccctccaactcggagcgcttctgcctggggctgctgtccaacgtgaacaggaac
gcggcggtggagctcaccaggcggcacatcgggcggggcgtgcggctctactacatcgga
ggggaggtcttcgccgagtgcctcagcgacagcgccatcttcgtccagtctcccaactgt
aaccagcgctatggctggcatccggccaccgtctgcaagatccctccagggtgcaacctg
aagatcttcaacaaccaggagttcgccgcgctcctggcccagtcggtgaaccagggcttc
gaggccgtctaccagctgacgcgcatgtgcaccatccgcatgagcttcgtcaaaggctgg
ggagccgagtacaggagacagacagtgaccagcaccccctgctggatcgagctgcacctg
aatgggcctttgcagtggctggacaaggtcctcacccagatgggctcccccagcatccgc
tgttccagtgtgtcctag

KEGG   Oryctolagus cuniculus (rabbit): 100359137
Entry
100359137         CDS       T03373                                 

Gene name
SMAD2
Definition
(RefSeq) SMAD family member 2
  KO
K04500  mothers against decapentaplegic homolog 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04144  Endocytosis
ocu04218  Cellular senescence
ocu04350  TGF-beta signaling pathway
ocu04371  Apelin signaling pathway
ocu04390  Hippo signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04659  Th17 cell differentiation
ocu04926  Relaxin signaling pathway
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu05142  Chagas disease
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05210  Colorectal cancer
ocu05212  Pancreatic cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100359137 (SMAD2)
   04390 Hippo signaling pathway
    100359137 (SMAD2)
   04371 Apelin signaling pathway
    100359137 (SMAD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100359137 (SMAD2)
  09143 Cell growth and death
   04110 Cell cycle
    100359137 (SMAD2)
   04218 Cellular senescence
    100359137 (SMAD2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100359137 (SMAD2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100359137 (SMAD2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100359137 (SMAD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100359137 (SMAD2)
   05205 Proteoglycans in cancer
    100359137 (SMAD2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100359137 (SMAD2)
   05212 Pancreatic cancer
    100359137 (SMAD2)
   05225 Hepatocellular carcinoma
    100359137 (SMAD2)
   05226 Gastric cancer
    100359137 (SMAD2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100359137 (SMAD2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100359137 (SMAD2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100359137 (SMAD2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100359137 (SMAD2)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 100359137
NCBI-ProteinID: XP_002713567
Ensembl: ENSOCUG00000011290
UniProt: G1T109
LinkDB
Position
9
AA seq 467 aa
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQS
MDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP
NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtcgtccatcttgccgttcactccgccagtggtgaagagactgctggggtggaagaag
tcggccggtggctctggaggagcgggaggaggggagcagaatggccaggaagagaagtgg
tgtgagaaggccgtgaagagtctggtgaagaagctgaagaaaacgggacgactagatgag
cttgagaaagccatcaccactcagaattgtaatactaaatgtgtcaccataccaagcact
tgctctgaaatttggggactgagtacaccaaatacgatagatcagtgggatacaacaggc
ctttacagcttctctgaacaaaccaggtctcttgacggtcgtcttcaggtgtcccatcgg
aaaggactgccgcatgttatatattgccggttgtggcgctggcctgaccttcacagccat
catgaactcaaggcaattgaaaactgcgaatatgctttcaatcttaaaaaggatgaagta
tgtgtaaacccttaccactaccagagagttgagacaccagttctgcctccagtattagtg
ccccggcacacggagatcttaactgaacttccacctctggatgactatacccactccatt
ccagaaaacactaactttcccgcaggaattgagccacagagtaattacatcccagaaaca
ccacctcctggatatatcagtgaagatggagaaacaagtgatcaacagttgaaccaaagt
atggacacaggctctccagcagaactgtctcctactactctttcccctgttaatcacagc
ttggatttgcagccagttacttattcagaaccggccttttggtgttcaatagcatattat
gaattgaaccagagggttggagagaccttccatgcctcacagccttccctcacagtagat
ggctttacagatccatcaaactcagagaggttctgcttagggttactgtccaatgtgaac
cgaaacgccacagtagaaatgacaagaagacatataggaagaggagtgcgcttatattac
ataggtggggaagtttttgctgagtgcctaagtgatagtgcaatctttgtgcagagcccc
aattgtaatcagagatacggctggcaccctgcaacagtgtgtaaaattccaccaggctgt
aatctcaagatcttcaacaaccaggaatttgctgctcttctggctcagtctgttaatcag
gggtttgaagccgtctatcagctaactagaatgtgcaccataagaatgagttttgtgaaa
ggctggggagcagaataccgaaggcagacagtcacaagtactccttgctggattgaactt
catctgaatggacctctacagtggttggacaaagtattaactcagatgggatccccgtca
gtgcgctgctcaagcatgtcgtaa

DBGET integrated database retrieval system