KEGG   Oryctolagus cuniculus (rabbit): 100346379
Entry
100346379         CDS       T03373                                 

Gene name
E2F2
Definition
(RefSeq) E2F transcription factor 2
  KO
K09389  transcription factor E2F2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01522  Endocrine resistance
ocu04110  Cell cycle
ocu04218  Cellular senescence
ocu04934  Cushing syndrome
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05163  Human cytomegalovirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05169  Epstein-Barr virus infection
ocu05200  Pathways in cancer
ocu05206  MicroRNAs in cancer
ocu05212  Pancreatic cancer
ocu05214  Glioma
ocu05215  Prostate cancer
ocu05218  Melanoma
ocu05219  Bladder cancer
ocu05220  Chronic myeloid leukemia
ocu05222  Small cell lung cancer
ocu05223  Non-small cell lung cancer
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100346379 (E2F2)
   04218 Cellular senescence
    100346379 (E2F2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100346379 (E2F2)
   05206 MicroRNAs in cancer
    100346379 (E2F2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100346379 (E2F2)
   05225 Hepatocellular carcinoma
    100346379 (E2F2)
   05226 Gastric cancer
    100346379 (E2F2)
   05214 Glioma
    100346379 (E2F2)
   05220 Chronic myeloid leukemia
    100346379 (E2F2)
   05218 Melanoma
    100346379 (E2F2)
   05219 Bladder cancer
    100346379 (E2F2)
   05215 Prostate cancer
    100346379 (E2F2)
   05224 Breast cancer
    100346379 (E2F2)
   05222 Small cell lung cancer
    100346379 (E2F2)
   05223 Non-small cell lung cancer
    100346379 (E2F2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100346379 (E2F2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100346379 (E2F2)
   05161 Hepatitis B
    100346379 (E2F2)
   05160 Hepatitis C
    100346379 (E2F2)
   05163 Human cytomegalovirus infection
    100346379 (E2F2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100346379 (E2F2)
   05169 Epstein-Barr virus infection
    100346379 (E2F2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100346379 (E2F2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100346379 (E2F2)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    100346379 (E2F2)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 100346379
NCBI-ProteinID: XP_008263913
Ensembl: ENSOCUG00000023896
UniProt: G1TGK6
LinkDB
Position
13
AA seq 438 aa
MLSGSRVLAPAAGQPLKGASAMSPTEPWPPGLSSPQLGPATTTTTYYTALYPQTVPPAAA
AGTCLDATPHGPEGQAVRCVPAGRLPAKRKLDLEGIGRPAVPEFRTPKGKCISLEGLPSP
KTPKSPGEKTRYDTSLGLLTKKFIYLLSESADGVLDLNWAAEVLAVQKRRIYDITNVLEG
IQLIRKKAKNHVQWVGRGMFEDPTRPGTQQQLRQELKELTSTEQALDQLIQGCSLSLKDL
TEDKANQRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDKTEDNLQIYLKSTQGPI
EVYLCPEEVQEPDSPATERLPSPARSPSPDSTHPSSTSPGREEPTSSSAPAPVPQQVPPP
PPPPPLVPLEATDSMLELPHPLLQQTEDQFLSPSLACSSPLISFSPPLEQDDYLWSLDGG
EGISDLFDSYDLGDLLIN
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgctgagcgggtcccgggtcctggccccggctgctgggcagcccctaaagggggcgtcg
gcgatgagccccaccgagccgtggccgcccggcctcagcagccctcagcttggcccggcc
accaccaccaccacctactacaccgcgctgtacccgcagacggtgcctcccgctgcggct
gccggcacctgcctcgacgccaccccccacggacccgagggccaagctgtccgctgcgtg
cccgcaggccggctgccggccaagaggaagctggacctggagggcatcgggaggcctgcg
gtccctgaattccgaactcccaaggggaagtgcatcagcctggaggggctgcccagcccc
aagacgcccaagtcccccggggagaagacgcgatacgacacgtcgctggggctgctcacc
aagaagttcatttacctgctgagtgagtcggccgacggggtcctggacctgaactgggcg
gcggaggtgctggccgtgcagaagcggcgcatctacgacatcaccaacgtgctcgagggc
atccagctcatccgcaagaaggccaagaaccacgtccagtgggtaggcaggggaatgttt
gaagaccccacccggcccgggacgcagcagcagctgaggcaggagctgaaggagctgacg
agcacagagcaggccttggaccagctcatccagggctgctctctgagcttaaaggacctg
accgaggacaaggccaaccagaggctggcctacgtgacgtaccaggacatccgtgctgtc
ggcaacttcaaggagcagacggtgattgccgtgaaggcgccgccgcagacgagactggaa
gtgcccgacaagaccgaggataatctgcagatatatctgaaaagcacccaagggcccatc
gaagtctacctgtgcccagaggaggtgcaggagccggacagtcctgccaccgagcgcctc
ccctcccctgcccgcagccccagccctgactccacccaccccagcagcaccagccctgga
agggaggaacccacgtcatcctcagcgccagcaccggttccccagcaggtcccgccgccg
ccgccgccgccgccgctcgtgcccttggaggccaccgacagcatgctggagctgccacac
ccattgctgcagcagaccgaggaccagttcctgtccccgagcctggcctgcagctccccg
ctcatcagcttctccccgcccttggagcaggatgactacctgtggagcctggacgggggc
gagggcatcagcgacctcttcgactcctacgacctgggggacctgctgattaactga

KEGG   Oryctolagus cuniculus (rabbit): 100353173
Entry
100353173         CDS       T03373                                 

Gene name
E2F3
Definition
(RefSeq) E2F transcription factor 3
  KO
K06620  transcription factor E2F3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01522  Endocrine resistance
ocu04110  Cell cycle
ocu04218  Cellular senescence
ocu04934  Cushing syndrome
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05163  Human cytomegalovirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05169  Epstein-Barr virus infection
ocu05200  Pathways in cancer
ocu05206  MicroRNAs in cancer
ocu05212  Pancreatic cancer
ocu05214  Glioma
ocu05215  Prostate cancer
ocu05218  Melanoma
ocu05219  Bladder cancer
ocu05220  Chronic myeloid leukemia
ocu05222  Small cell lung cancer
ocu05223  Non-small cell lung cancer
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100353173 (E2F3)
   04218 Cellular senescence
    100353173 (E2F3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100353173 (E2F3)
   05206 MicroRNAs in cancer
    100353173 (E2F3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100353173 (E2F3)
   05225 Hepatocellular carcinoma
    100353173 (E2F3)
   05226 Gastric cancer
    100353173 (E2F3)
   05214 Glioma
    100353173 (E2F3)
   05220 Chronic myeloid leukemia
    100353173 (E2F3)
   05218 Melanoma
    100353173 (E2F3)
   05219 Bladder cancer
    100353173 (E2F3)
   05215 Prostate cancer
    100353173 (E2F3)
   05224 Breast cancer
    100353173 (E2F3)
   05222 Small cell lung cancer
    100353173 (E2F3)
   05223 Non-small cell lung cancer
    100353173 (E2F3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100353173 (E2F3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100353173 (E2F3)
   05161 Hepatitis B
    100353173 (E2F3)
   05160 Hepatitis C
    100353173 (E2F3)
   05163 Human cytomegalovirus infection
    100353173 (E2F3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100353173 (E2F3)
   05169 Epstein-Barr virus infection
    100353173 (E2F3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100353173 (E2F3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100353173 (E2F3)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    100353173 (E2F3)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 100353173
NCBI-ProteinID: XP_017200454
LinkDB
Position
12
AA seq 351 aa
MCDSRTICDGEYHRFDWAKRRLELGESGHQYLSDGLKTPKGKGRAALRSPDSPKTPKSPS
EKTRYDTSLGLLTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKK
SKNNVQWMGCSLSEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQ
RLAYVTYQDIRKISGLKDQTVIVVKAPPETRLEVPDSIESLQIHLASTQGPIEVYLCSEE
TETHSPVKTNNQDHNGNIPKPTSKDLASTNSGHSDCSISMANLSPLASPANLLQQTEDQI
PSNLEGPFVNLLPPLLQEDYLLSLGEDEGISDLFDAYDLEKLPLVEDFMCS
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgtgtgactctaggactatttgcgatggtgaataccacagatttgactgggccaagcga
aggctggagctcggagaaagtgggcatcagtacctctccgatggtttaaaaacccccaag
ggcaaaggaagagctgcactacgaagtccagatagcccaaaaactccaaaatctccctca
gaaaaaacgcggtatgacacgtcccttggtctgctcaccaagaagttcattcagctgctg
agccagtcgcccgacggggtcttggacttgaacaaggcggccgaggtgctcaaggtgcag
aagagaaggatctacgacatcaccaacgtcctggaaggcatccacctcatcaagaaaaag
tccaaaaacaacgtgcaatggatgggctgcagtctgtctgaggacgggggcatgctggcc
cagtgccaaggcctgtccaaagaagtgaccgagctcagtcaggaagagaagaaattagat
gaactgatccaaagctgcaccttggacctcaaactgttaaccgaggattcagagaatcaa
aggttagcttacgttacatatcaagatattcgaaaaattagtggccttaaagaccaaact
gttatagtcgtgaaagcccctccagaaacaagacttgaagtgcctgactccatagagagc
ctacagatacacttggcaagtacccaaggacccattgaggtttacttgtgttcagaagag
actgaaacacacagtcccgtgaaaacgaacaaccaagaccacaatgggaatatccccaaa
cccacttccaaagacttggcttcaaccaactcaggacatagcgactgctccatttctatg
gcgaacctttctcctctggcctccccagccaacctcttacagcagactgaggaccaaatc
ccttccaacctggaagggcccttcgtgaacttgctgccgcccctgctgcaggaggactac
ctgctgagcctcggggaggacgagggcatcagcgacctcttcgacgcttacgatttggag
aagctcccgctggtggaggattttatgtgtagttga

KEGG   Oryctolagus cuniculus (rabbit): 100356957
Entry
100356957         CDS       T03373                                 

Gene name
E2F1
Definition
(RefSeq) E2F transcription factor 1
  KO
K17454  transcription factor E2F1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01522  Endocrine resistance
ocu04110  Cell cycle
ocu04137  Mitophagy - animal
ocu04218  Cellular senescence
ocu04934  Cushing syndrome
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05163  Human cytomegalovirus infection
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05169  Epstein-Barr virus infection
ocu05200  Pathways in cancer
ocu05206  MicroRNAs in cancer
ocu05212  Pancreatic cancer
ocu05214  Glioma
ocu05215  Prostate cancer
ocu05218  Melanoma
ocu05219  Bladder cancer
ocu05220  Chronic myeloid leukemia
ocu05222  Small cell lung cancer
ocu05223  Non-small cell lung cancer
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100356957 (E2F1)
  09143 Cell growth and death
   04110 Cell cycle
    100356957 (E2F1)
   04218 Cellular senescence
    100356957 (E2F1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100356957 (E2F1)
   05206 MicroRNAs in cancer
    100356957 (E2F1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100356957 (E2F1)
   05225 Hepatocellular carcinoma
    100356957 (E2F1)
   05226 Gastric cancer
    100356957 (E2F1)
   05214 Glioma
    100356957 (E2F1)
   05220 Chronic myeloid leukemia
    100356957 (E2F1)
   05218 Melanoma
    100356957 (E2F1)
   05219 Bladder cancer
    100356957 (E2F1)
   05215 Prostate cancer
    100356957 (E2F1)
   05224 Breast cancer
    100356957 (E2F1)
   05222 Small cell lung cancer
    100356957 (E2F1)
   05223 Non-small cell lung cancer
    100356957 (E2F1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100356957 (E2F1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100356957 (E2F1)
   05161 Hepatitis B
    100356957 (E2F1)
   05160 Hepatitis C
    100356957 (E2F1)
   05163 Human cytomegalovirus infection
    100356957 (E2F1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100356957 (E2F1)
   05169 Epstein-Barr virus infection
    100356957 (E2F1)
   05165 Human papillomavirus infection
    100356957 (E2F1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100356957 (E2F1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100356957 (E2F1)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    100356957 (E2F1)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP TP1
Other DBs
NCBI-GeneID: 100356957
NCBI-ProteinID: XP_008254327
Ensembl: ENSOCUG00000000856
LinkDB
Position
4
AA seq 411 aa
AQLRLLYSSQIVIISAAQDASAPPAPAGPAAGSHDPDLLLFATPQAPRPTPSAPRPALGR
PPVKRRLDLETDHQYLAESSVPVRGRGRHPGKGVKSPGEKSRYETSLNLTTKRFLELLSR
SADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLIAKKSKNHIQWLGSHTTVGIGGRLEG
LTQDLRQLEESEQQLDHLMHLCATQLRLLSEDSDSQRLAYVTCQDLRSIVDPAEQMVMVI
KAPPETQLQAVDSAETFQISLKSKQGPIDVFLCPEESAGAISPGKTPTQGVASGEEDRTA
DSATLVPPLSSPPSSPALDPSQSLLSLEQEPLLSRMGGLRAPVDEDRLSPLVAADSLLEH
VREDFSSLLPEEFISLSPPHETLDYHFGLEEGEGIRDLFDCDFGDLTPLDF
NT seq 1236 nt   +upstreamnt  +downstreamnt
gcgcagctgcgactgctgtactcctcgcagatcgtcatcatctccgcggcgcaggacgcc
agcgccccgccggcccccgccggccccgccgcgggctctcacgaccccgacctgctgctc
ttcgccacgccgcaggcgccccgacccacacccagcgcgccgcgtccggcgctcggccgc
ccgccggtgaagcggagactggacctggaaactgaccatcaatacctggctgaaagcagt
gtgcccgtccggggcagaggccgccacccggggaaaggtgtgaaatcccctggggagaag
tcacgctatgagacctcgctgaacctgaccaccaaacgcttcctggagctgctgagccgc
tcagctgatggcgttgttgacctgaactgggcggccgaggtgctgaaggtgcagaaacgg
cgcatctacgacatcaccaacgtccttgagggcatccagctcattgccaagaagtccaag
aaccacatccagtggctaggcagccacaccacggtgggcatcggcggacggcttgaaggg
ctaacacaggacctccggcagctggaggagagcgagcagcagctggaccacctgatgcac
ctctgtgccacacagctgcggctgctttctgaggactctgacagccagcgcctggcctac
gtgacctgccaggaccttcggagcattgtggatcctgcagagcagatggtcatggtgatc
aaggctcctcctgagacccagctccaagctgtggactccgcagagacctttcagatctcc
cttaagagcaaacaaggccccatcgatgttttcctgtgccctgaggagagtgcgggcgcg
atcagtcctgggaagaccccgacccagggcgtggcatctggggaggaagacaggacagct
gactctgccaccttggttccacctttgtcatctcctccctcatcccctgctctggatccc
agccagtcccttctcagcctggagcaagaaccgctgctatcccgcatgggtggcctccga
gcccccgtggatgaggaccgcctgtccccactggtggcagctgactcgctcctggagcac
gtgcgggaggacttctccagcctcctccccgaggagttcatcagcctttcccctccccat
gagaccctcgactaccacttcggcctcgaggagggggagggcattagagacctctttgac
tgtgactttggggatctcaccccgctggatttctga

DBGET integrated database retrieval system