KEGG   Oryctolagus cuniculus (rabbit): 100346391
Entry
100346391         CDS       T03373                                 

Gene name
SOS2
Definition
(RefSeq) SOS Ras/Rho guanine nucleotide exchange factor 2
  KO
K03099  son of sevenless
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu01522  Endocrine resistance
ocu04010  MAPK signaling pathway
ocu04012  ErbB signaling pathway
ocu04014  Ras signaling pathway
ocu04062  Chemokine signaling pathway
ocu04068  FoxO signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04150  mTOR signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04510  Focal adhesion
ocu04540  Gap junction
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04660  T cell receptor signaling pathway
ocu04662  B cell receptor signaling pathway
ocu04664  Fc epsilon RI signaling pathway
ocu04714  Thermogenesis
ocu04722  Neurotrophin signaling pathway
ocu04810  Regulation of actin cytoskeleton
ocu04910  Insulin signaling pathway
ocu04912  GnRH signaling pathway
ocu04915  Estrogen signaling pathway
ocu04917  Prolactin signaling pathway
ocu04926  Relaxin signaling pathway
ocu04935  Growth hormone synthesis, secretion and action
ocu05034  Alcoholism
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05163  Human cytomegalovirus infection
ocu05165  Human papillomavirus infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05206  MicroRNAs in cancer
ocu05210  Colorectal cancer
ocu05211  Renal cell carcinoma
ocu05213  Endometrial cancer
ocu05214  Glioma
ocu05215  Prostate cancer
ocu05220  Chronic myeloid leukemia
ocu05221  Acute myeloid leukemia
ocu05223  Non-small cell lung cancer
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100346391 (SOS2)
   04012 ErbB signaling pathway
    100346391 (SOS2)
   04014 Ras signaling pathway
    100346391 (SOS2)
   04630 JAK-STAT signaling pathway
    100346391 (SOS2)
   04068 FoxO signaling pathway
    100346391 (SOS2)
   04072 Phospholipase D signaling pathway
    100346391 (SOS2)
   04151 PI3K-Akt signaling pathway
    100346391 (SOS2)
   04150 mTOR signaling pathway
    100346391 (SOS2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100346391 (SOS2)
   04540 Gap junction
    100346391 (SOS2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100346391 (SOS2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100346391 (SOS2)
   04660 T cell receptor signaling pathway
    100346391 (SOS2)
   04662 B cell receptor signaling pathway
    100346391 (SOS2)
   04664 Fc epsilon RI signaling pathway
    100346391 (SOS2)
   04062 Chemokine signaling pathway
    100346391 (SOS2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100346391 (SOS2)
   04912 GnRH signaling pathway
    100346391 (SOS2)
   04915 Estrogen signaling pathway
    100346391 (SOS2)
   04917 Prolactin signaling pathway
    100346391 (SOS2)
   04926 Relaxin signaling pathway
    100346391 (SOS2)
   04935 Growth hormone synthesis, secretion and action
    100346391 (SOS2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100346391 (SOS2)
  09159 Environmental adaptation
   04714 Thermogenesis
    100346391 (SOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100346391 (SOS2)
   05206 MicroRNAs in cancer
    100346391 (SOS2)
   05205 Proteoglycans in cancer
    100346391 (SOS2)
   05231 Choline metabolism in cancer
    100346391 (SOS2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100346391 (SOS2)
   05225 Hepatocellular carcinoma
    100346391 (SOS2)
   05226 Gastric cancer
    100346391 (SOS2)
   05214 Glioma
    100346391 (SOS2)
   05221 Acute myeloid leukemia
    100346391 (SOS2)
   05220 Chronic myeloid leukemia
    100346391 (SOS2)
   05211 Renal cell carcinoma
    100346391 (SOS2)
   05215 Prostate cancer
    100346391 (SOS2)
   05213 Endometrial cancer
    100346391 (SOS2)
   05224 Breast cancer
    100346391 (SOS2)
   05223 Non-small cell lung cancer
    100346391 (SOS2)
  09165 Substance dependence
   05034 Alcoholism
    100346391 (SOS2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100346391 (SOS2)
   05160 Hepatitis C
    100346391 (SOS2)
   05163 Human cytomegalovirus infection
    100346391 (SOS2)
   05165 Human papillomavirus infection
    100346391 (SOS2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100346391 (SOS2)
   01522 Endocrine resistance
    100346391 (SOS2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ocu04990]
    100346391 (SOS2)
Domain-containing proteins not elsewhere classified [BR:ocu04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   100346391 (SOS2)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH IQ_SEC7_PH PH_13
Other DBs
NCBI-GeneID: 100346391
NCBI-ProteinID: XP_002718345
Ensembl: ENSOCUG00000006052
LinkDB
Position
17
AA seq 1333 aa
MQQAPQLYEFFSEENSPKWRGLLVPALRKVQEQVHPNLSANEESLYYIEELIFQLLNKLC
MAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
IGLVSLCEEEPSSSGELNYYDLVRTEIAAERQYLRELNMIIKVFREAFLSDRKLFKPSDI
EKIFSNISDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDI
LSPEFNEHFSKLMARPGVALHFQSIADGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLKA
CSEEQEDRECLNQAITALMNLQGSMDRIYKQYSPRRRPGDPVCPFYNRQLRSKHLAIKKM
NEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMISCKPNHGQTRLPG
YSSAEYRLKEKFVMRKIQICDKEDTCECKHAFELVSKEENSITFAAKSAEEKNNWMAALI
SLHYRSTLDRMLDSVLLKEENEQPLRLPSPEVYRFVVKDSEENIVFEDNLQSRSGIPIIK
GGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADKLA
IEKGEQPISADLKRFRKEYVQPVQLRILNVFRHWVEHHFYDFERDSELLERLESFISSVR
GKAMKKWVESIAKIIKRKKQAQANGISHNITFESPPPPIEWHISKPGQFETFDLMTLHPI
EIARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEA
ENFEERVSILSRIIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRRILD
EAVELSQDHFKKYLVKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKKGKDLINFSKRR
KVAEITGEIQQYQNQPYCLRIEPEMRRFFENLNPMGSASEKEFTDYLFNKSLEIEPRNCK
QPPRFPRKTTISLKSPGIRPNTGRHGSTSGTLRGHPTPLEREPYKISFSRIAETELESTV
SAPTSPNTPSTPPVSASSDLSSVFLDVDLNSSCGSNSIFAPVLLPHSKSFFSSCGSLHKL
SEEPLIPPPLPPRKKVDHDVSNSKGNMKSDDDPPAIPPRQPPPPKVKPRVPVPASAFDGP
LHSPPPPPPRDPLPDTPPPVPLRPPEHFINCPFNLQPPPLGHLHRDPEWFRDVNTCPNSP
STPPSTPSPRVPRRCYVLSSSHNNLVHPPAPPVPPRQNSSPHLPKLPPKTYKRELSHPPL
YGLSLLENAETPQ
NT seq 4002 nt   +upstreamnt  +downstreamnt
atgcagcaggcgccgcagctgtacgagttcttcagcgaggagaacagcccgaaatggcgg
ggattgttggtcccggccctgcggaaggttcaggagcaagtacatcccaatctctcagct
aatgaagagtctctctattatattgaagagctgatttttcagctgcttaataaattatgc
atggcccagccaagaactgttcaagatgtggaggaacgagttcaaaagacctttcctcat
ccaattgataaatgggctattgctgatgcacaatctgccatagagaaacgaaaacgaaga
aatcctcttttactgcctgtggacaaaatccatccttcgttgaaggaagttttagggtac
aaggtggattaccatgtgtccctatatattgtggctgtactagagtatatctcagctgat
attttgaaattggctggtaattatgtttttaatatccgacattatgaaatatctcagcaa
gacattaaagtgtcaatgtgtgcagataaggttttgatggacatgtttgatcaggatgac
ataggtttggtttctctctgtgaggaagaacctagttcttcaggagaattaaactactac
gaccttgtaagaactgaaattgcagcagaaaggcagtatctacgggaactaaatatgatc
ataaaagtgtttcgagaagccttcctgtctgacagaaagctttttaaaccttctgatatt
gaaaagattttcagcaacatttcagatattcatgagttaactgtgaagctgttaggcttg
attgaagacacagttgaaatgactgatgaaagcagtccgcatcccttagctggcagctgt
tttgaagatttggcagaagagcaagcatttgatccttacgaaacgttgtcccaggacatt
ctttcaccagagtttaatgaacatttcagtaagttgatggccagacctggtgttgctcta
cactttcagtccattgctgatggctttaaagaggcagttcgttatgtccttccacgcctt
atgctagttccagtgtatcattgttggcattattttgaattattaaagcaattgaaagca
tgtagtgaagagcaagaagacagagagtgtctgaaccaagctattactgctctcatgaat
ctccaaggtagtatggaccgaatatacaagcagtattcacctagacgccgacctggggat
cctgtttgccccttttataatcgtcagttaagaagtaagcacctggctatcaaaaaaatg
aatgaaattcagaaaaatatagatggatgggaaggcaaagatattggacagtgttgtaac
gaattcattatggaaggaccattgacaagaattggtgcaaagcatgaacggcatattttt
ctctttgatggcttaatgatcagctgtaaacctaatcatggccagacccggcttccaggc
tacagcagtgcagaatacagattaaaagaaaaatttgtcatgaggaaaatacaaatctgt
gataaagaagatacttgtgaatgcaagcatgcttttgaattggtgtccaaagaagaaaac
agcataacatttgctgctaagtcagctgaagagaaaaataattggatggctgcccttatc
tctcttcattaccgcagcactctagatcgaatgctggattctgtattattgaaagaagaa
aatgagcaaccactgagattaccaagtccagaagtgtatcgttttgtggtaaaagactct
gaggaaaacattgtttttgaagacaacttgcaaagtagaagtggaatccctattataaaa
ggaggaactgttgtgaaattaattgaaaggttaacatatcatatgtatgcagatcccaat
tttgttcgtacttttcttactacatatcgttcgttttgtaaaccacaagaattgctaagc
ttactgattgaacggtttgaaattccagaacctgaacctactgaagccgacaaattggca
atagagaaaggggagcagccaatcagtgcagaccttaaaagatttcgcaaggagtatgtg
caaccagtacaactgaggatcttaaatgtatttcggcactgggttgaacaccatttttat
gactttgaaagagattcggaattgcttgaaagattagaatccttcatttcaagtgtaaga
gggaaagctatgaagaagtgggtagaatcaattgctaagatcatcaagaggaagaagcaa
gctcaggcaaatggaataagccataatattacctttgagagtccacctccaccaattgaa
tggcatatcagcaagcctggacagtttgaaacatttgatctcatgacactgcatccaata
gaaatcgcacgtcagctaacacttttggaatctgatctttacaggaaagtccaaccttct
gagcttgtggggagtgtgtggaccaaagaagataaagaaataaattctccaaatttatta
aaaatgattcgtcataccacaaatcttaccctctggtttgaaaaatgcattgtggaagca
gaaaattttgaagaacgtgtgtcaatactaagtagaattatagaaattctgcaagttttt
caagatttgaataatttcaatggtgtattggagatcgtcagtgcagtaaattcagtgtca
gtgtacagactagaccataccttcgaggcattgcaggaaagaaaacgaagaattttggat
gaagctgttgaattgagtcaagatcactttaaaaaatacctagtaaaacttaagtcaatc
aatccaccttgtgtgcctttttttggaatatatttaacaaatatactgaagactgaagaa
ggaaataatgatttcttaaaaaagaaagggaaagacttaatcaatttcagtaagaggagg
aaagttgctgaaattactggggaaattcagcaatatcagaatcagccttactgtttacgg
atagaaccagaaatgaggagattctttgaaaaccttaaccccatgggaagtgcatctgaa
aaagagtttacagattatttgttcaacaagtctctagaaattgaaccccgaaactgcaag
cagccacctcgatttcccaggaaaacaaccatctccttaaaatctcctggaataaggccc
aatacaggccgacatggctctacctcaggcactttacgaggtcatccaacgccattagaa
agagaaccgtataaaataagctttagtcggattgctgaaactgagcttgaatcaacagtg
tcagcaccaacctctccaaatacaccatctactccaccagtatctgcttcttcagacctt
agtagtgtgtttttagatgtggatctcaacagttcctgtggcagcaatagcatctttgct
ccagtgctcttgccacattcaaagtccttcttcagttcctgtggtagtttacataaatta
agtgaagagccactgattcctccccctcttcctcctcgaaaaaaggttgatcacgatgtg
tcaaattccaaggggaatatgaaatctgatgatgaccctcctgctattccaccgagacag
cctcctcctccaaaggtaaaacccagagttcctgttcctgctagtgcatttgatggacct
ctgcacagcccacctccaccaccgccaagagatcctcttcctgatacccctccaccggtt
ccccttcggcctccagaacactttatcaactgtccatttaatcttcagcctcctccactg
ggacatcttcaccgagatccagagtggttcagagacgttaatacatgtccgaattcacca
agcactcctcctagcactccctctccaagggtaccgcgtcgatgctatgttcttagttct
agtcacaataatcttgttcatcctccagctccacctgtccctccaaggcagaattcaagc
cctcacctaccaaaactgccaccaaagacttacaaacgggaactttcgcaccctccgttg
tatggactgtctttgttagaaaatgcagaaactcctcaatga

KEGG   Oryctolagus cuniculus (rabbit): 100356615
Entry
100356615         CDS       T03373                                 

Gene name
SOS1
Definition
(RefSeq) SOS Ras/Rac guanine nucleotide exchange factor 1
  KO
K03099  son of sevenless
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu01522  Endocrine resistance
ocu04010  MAPK signaling pathway
ocu04012  ErbB signaling pathway
ocu04014  Ras signaling pathway
ocu04062  Chemokine signaling pathway
ocu04068  FoxO signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04150  mTOR signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04510  Focal adhesion
ocu04540  Gap junction
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04660  T cell receptor signaling pathway
ocu04662  B cell receptor signaling pathway
ocu04664  Fc epsilon RI signaling pathway
ocu04714  Thermogenesis
ocu04722  Neurotrophin signaling pathway
ocu04810  Regulation of actin cytoskeleton
ocu04910  Insulin signaling pathway
ocu04912  GnRH signaling pathway
ocu04915  Estrogen signaling pathway
ocu04917  Prolactin signaling pathway
ocu04926  Relaxin signaling pathway
ocu04935  Growth hormone synthesis, secretion and action
ocu05034  Alcoholism
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05163  Human cytomegalovirus infection
ocu05165  Human papillomavirus infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05206  MicroRNAs in cancer
ocu05210  Colorectal cancer
ocu05211  Renal cell carcinoma
ocu05213  Endometrial cancer
ocu05214  Glioma
ocu05215  Prostate cancer
ocu05220  Chronic myeloid leukemia
ocu05221  Acute myeloid leukemia
ocu05223  Non-small cell lung cancer
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100356615 (SOS1)
   04012 ErbB signaling pathway
    100356615 (SOS1)
   04014 Ras signaling pathway
    100356615 (SOS1)
   04630 JAK-STAT signaling pathway
    100356615 (SOS1)
   04068 FoxO signaling pathway
    100356615 (SOS1)
   04072 Phospholipase D signaling pathway
    100356615 (SOS1)
   04151 PI3K-Akt signaling pathway
    100356615 (SOS1)
   04150 mTOR signaling pathway
    100356615 (SOS1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100356615 (SOS1)
   04540 Gap junction
    100356615 (SOS1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100356615 (SOS1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100356615 (SOS1)
   04660 T cell receptor signaling pathway
    100356615 (SOS1)
   04662 B cell receptor signaling pathway
    100356615 (SOS1)
   04664 Fc epsilon RI signaling pathway
    100356615 (SOS1)
   04062 Chemokine signaling pathway
    100356615 (SOS1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100356615 (SOS1)
   04912 GnRH signaling pathway
    100356615 (SOS1)
   04915 Estrogen signaling pathway
    100356615 (SOS1)
   04917 Prolactin signaling pathway
    100356615 (SOS1)
   04926 Relaxin signaling pathway
    100356615 (SOS1)
   04935 Growth hormone synthesis, secretion and action
    100356615 (SOS1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100356615 (SOS1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100356615 (SOS1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100356615 (SOS1)
   05206 MicroRNAs in cancer
    100356615 (SOS1)
   05205 Proteoglycans in cancer
    100356615 (SOS1)
   05231 Choline metabolism in cancer
    100356615 (SOS1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100356615 (SOS1)
   05225 Hepatocellular carcinoma
    100356615 (SOS1)
   05226 Gastric cancer
    100356615 (SOS1)
   05214 Glioma
    100356615 (SOS1)
   05221 Acute myeloid leukemia
    100356615 (SOS1)
   05220 Chronic myeloid leukemia
    100356615 (SOS1)
   05211 Renal cell carcinoma
    100356615 (SOS1)
   05215 Prostate cancer
    100356615 (SOS1)
   05213 Endometrial cancer
    100356615 (SOS1)
   05224 Breast cancer
    100356615 (SOS1)
   05223 Non-small cell lung cancer
    100356615 (SOS1)
  09165 Substance dependence
   05034 Alcoholism
    100356615 (SOS1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100356615 (SOS1)
   05160 Hepatitis C
    100356615 (SOS1)
   05163 Human cytomegalovirus infection
    100356615 (SOS1)
   05165 Human papillomavirus infection
    100356615 (SOS1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100356615 (SOS1)
   01522 Endocrine resistance
    100356615 (SOS1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ocu04990]
    100356615 (SOS1)
Domain-containing proteins not elsewhere classified [BR:ocu04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   100356615 (SOS1)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH PH_19 PH_10 IQ_SEC7_PH PH_13
Other DBs
NCBI-GeneID: 100356615
NCBI-ProteinID: XP_008252712
Ensembl: ENSOCUG00000007844
LinkDB
Position
2
AA seq 1276 aa
MLCQAQPRSASDVEERVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPVEKIHPLLKEV
LGYKIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITKQDIKVAMCADKVLMDMFH
QDVEDINILSLTDEEPSTSGEQTYYDLVKAFMAEIRQYIRELNLIIKVFREPFVSNSKLF
SANDVENIFSRIVDIHELSVKLLGHIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYES
YARDILRPGFHDRFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELL
KQLEEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQL
AIKKMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQ
PRLPGASNAEYRLKEKFFMRKVQINDKDDTSEYKHAFEIILKDENSVIFSAKSAEEKNNW
MAALISLQYRSTLERMLDVTMLQEEKEEQMRLPSADVYRFAEPDSEENILFEENVQPKAG
IPIIKAGTVIKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLIIERFEIPEPEPTE
ADRIAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDADLLQRMEEF
IGTVRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPAVEWHISRPGHIETFDLL
TLHPIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEK
CIVETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQ
KKILEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLKRHGKELIN
FSKRRKVAEITGEIQQYQNQPYCLRVESDIKRFFENLNPMGNSMEKEFTDYLFHKSLEIE
PRNPKPLPRFPKKYSYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETESTA
SAPNSPRTPLTPPPASGASSTTDVCSVFDSDHSSPFHSSSDTVFIQVTLPHGPRSASVSS
ISLTKGTDEVPVPPPVPPRRRPESAPAESSPSKIMSKHLDSPPAIPPRQPTSKAYSPRYS
ISDRTSVSDPPESPPLLPPREPVRTPDVFSSSPLHLQPPPLGKKSDHGNAFFPNSPSPFT
PLPPQTPSPHGTRRHLPSPPLTQEVDLHSIAGPPVPPRQSTSQHIPKLPPKTYKREHTHP
SMHRDGPPLLENAHSS
NT seq 3831 nt   +upstreamnt  +downstreamnt
atgctatgtcaagctcagccccgaagtgcttcagatgtagaggaacgtgttcaaaaaagt
tttcctcatccaattgataagtgggcaatagctgatgcccaatcggctattgaaaagagg
aagcgaagaaaccctttatctctcccagtagaaaaaattcatcctttattaaaggaggtc
ctaggttataaaattgaccaccaggtttctgtttacatagtagcagtattagaatatatt
tctgcagacattttaaaactggtggggaattatgtaagaaatatacggcattatgaaatt
acaaaacaagacattaaagtggcaatgtgcgctgataaggtattgatggatatgtttcat
caagatgtggaagatataaacatattgtctttaactgatgaagagccttccacctcagga
gaacaaacttactatgatttggtaaaggcatttatggcagaaattcgacaatatataagg
gaactgaatctaattataaaagtttttagagagccctttgtctccaattcaaaattgttt
tcagctaatgatgtagaaaatatatttagtcgtatagtagatatacatgaacttagtgta
aagttactgggccacatagaagacactgtagaaatgactgatgaaggcagtccccaccca
ttagtaggaagctgttttgaagacttagcagaggaattggcatttgatccatatgaatcg
tatgcccgagatattttacgacctggttttcatgatcgtttccttagtcaattatcaaag
cctggggcagcactttacttgcagtcaataggcgaaggttttaaagaagctgttcaatat
gttttaccgaggctacttctagcccctgtttaccactgtcttcattactttgaacttttg
aagcagttagaagaaaagagtgaggatcaagaagacaaggaatgcttgaaacaggcaata
acagctctgcttaatgttcagagtggtatggaaaaaatatgttctaaaagtcttgcaaaa
cgaagactgagtgaatctgcatgtcggttttatagtcagcaaatgaaggggaaacaacta
gcaatcaagaaaatgaacgaaattcagaagaatattgatggttgggagggaaaagacatt
ggacagtgttgcaatgagtttataatggaaggaactcttacacgcgtaggtgccaaacat
gagagacacatctttctctttgacggcttaatgatttgctgtaaatcaaatcacgggcag
ccaagactccctggtgctagcaatgcagaataccgtcttaaagaaaagttttttatgcga
aaggtacaaattaatgacaaagatgacaccagtgaatacaagcatgcttttgaaataatt
ttaaaagatgaaaatagtgttatattttctgcgaagtcagctgaagagaaaaacaactgg
atggcagcactgatatctttacagtaccggagcaccctggaaaggatgcttgatgtaaca
atgctacaggaagagaaggaggagcagatgaggctgcctagtgctgatgtttacagattc
gcagagcctgactctgaagagaatattctatttgaagagaacgtgcagcccaaggctgga
attccaattatcaaagcaggaactgtgattaagcttatagagaggcttacgtaccatatg
tatgcagatcccaattttgttcggacatttcttacaacatacagatccttttgcaaacct
caagaactactgagtcttataatagaaaggtttgaaattccagaacctgagccaacagaa
gctgatcgcatagctatagagaatggagatcaacctctgagcgcagaactaaaaaggttt
agaaaagaatatatacagcctgtacagctgcgagtattaaatgtatgtcggcactgggta
gaacaccacttctatgattttgaaagagatgcagaccttttgcagcgaatggaggaattt
attggaacagtaagaggtaaagcaatgaaaaaatgggttgaatctatcactaagataatt
caaaggaaaaaaattgcaagagacaatggaccaggtcataatattacatttcagagctca
cctcccgcagttgagtggcatataagcagacccgggcacatcgagacttttgacctgctc
accttacacccaattgaaattgctcgacaactcactttactggaatcagatctataccga
gctgtgcagccatcagaattagttggaagtgtgtggacaaaagaagacaaagaaattaat
tctcctaatcttctgaaaatgatccgacacaccactaatctcactttgtggtttgaaaaa
tgtattgtagaaactgaaaatttagaagaaagagtagctgtggtgagtcgaataattgaa
attctgcaagtttttcaagagctgaacaacttcaatggtgtccttgaggttgtcagtgct
atgaactcatcacctgtttacagactagaccacacatttgagcaaataccaagtcgccaa
aagaaaattttagaggaagctcatgaactgagtgaagatcactataagaaatatttggca
aaactcaggtctattaatccaccatgtgtgcctttctttggaatttatctcactaatatt
ttaaaaacagaagagggcaaccctgaggttctgaaaagacatggaaaagagcttatcaac
ttcagcaaaaggaggaaagtagcagaaataacaggcgagatccaacagtaccaaaatcag
ccttattgtttacgagtagaatcagatatcaaaaggttctttgaaaacctgaatccaatg
ggaaacagcatggaaaaagaattcacagactatctcttccacaaatccctagaaatagaa
ccacgaaaccctaagcctctcccaagatttccaaaaaaatatagctatccccttaagtct
cctggtgttcgtccatcaaacccaagaccaggaaccatgaggcatcctacacctctgcag
caggaaccaaggaaaattagttatagtcggatcccggagagtgaaacagaaagtacagca
tctgctccaaattctcccagaacaccattgacacctcctcctgcttctggtgcttccagt
accacggatgtgtgcagtgtgtttgattctgatcattcaagcccttttcactcaagcagc
gataccgtctttatccaagtaacactgccccatggcccaagatctgcttcagtatcatct
ataagtttaaccaagggcactgatgaagtgcctgtcccccctcctgttcctccacgaaga
cgaccagaatctgccccagcggaatcttctccatctaagattatgtctaagcacttggac
agccccccagccattcctcctaggcaacccacatcaaaagcctattcaccacgatactcg
atatcagatcggacctctgtatcagaccctcctgaaagccctcccttattaccaccacga
gaacctgtgaggacacctgatgttttctcaagctcaccactacatctccaacctccccct
ttgggcaaaaaaagtgaccatggcaatgccttcttcccaaacagcccttccccctttact
ccactgcctcctcaaacaccttctcctcatggcacgagaaggcacctgccgtcaccacca
ttgacacaagaagtggacctccattccattgctgggcctcctgttcctccacgacaaagc
acttctcaacatatccctaaactccctccgaaaacttacaaaagggagcacacacaccca
tccatgcacagagacggacctccactgctggagaatgcccattcttcctga

DBGET integrated database retrieval system