KEGG   Oryctolagus cuniculus (rabbit): 100346548
Entry
100346548         CDS       T03373                                 

Gene name
GORAB
Definition
(RefSeq) golgin, RAB6 interacting
  KO
K19748  RAB6-interacting golgin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100346548 (GORAB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100346548 (GORAB)
Membrane trafficking [BR:ocu04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    100346548 (GORAB)
SSDB
Motif
Pfam: Transcrip_act FixH DUF1127
Other DBs
NCBI-GeneID: 100346548
NCBI-ProteinID: XP_002715257
Ensembl: ENSOCUG00000017965
UniProt: G1TEV0
LinkDB
Position
13
AA seq 394 aa
MCLGGRVGESRAIGLGILGFWLPERMAQSWAGFSEEELRRLKQTKDPFEPQRRAPVKKSR
QQIQREKALLEQSQKLGLQDGSTLLPPEQLLSAPKQRSNTQKPLSSPPALPSTLTLTSPV
GDGKPQCIESQPREPRLENSHDAHKNVEVSPPKPDCKLEKKKVELQEKSRWEVLQQEQRL
MEEKNKRKKALLAKAIAERSKRTQAETMKLKRIQKELQALDDMVSADIGILRNRIDQASL
DYSYARKRFDRAEAEYITAKLDLQRKTEIKEQLTEHLCTIIQQNELRKAKKLEELMQQLD
VQADEETLELEVEVERLLHEQEAEARRQMAHLERPFQPAGDSVTTGFADENKKYQEQAVS
LKIDEQCENSKSILLPSLGCPNQEVNGISADGTT
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgtgcctgggcggccgtgttggcgaatccagggctataggtttgggtatcctggggttt
tggctgccggagcggatggcgcagagctgggccggcttttctgaggaggagctgaggaga
ctaaagcagactaaagatccatttgaaccacagcggcgtgcccctgtaaagaaaagtcga
cagcagattcagcgagaaaaagctcttttagagcaaagccagaaacttggacttcaagat
ggatcaaccttattacctccagagcagctgctttctgcaccgaaacagagatctaacact
caaaaaccactttcttctccccctgctcttccaagcactctcacccttacctctcctgtt
ggtgatggaaaacctcagtgtattgaaagccaaccaagagaaccaagacttgagaattcc
catgatgctcacaaaaatgttgaggtttcacctcccaagccagattgcaaattggagaaa
aagaaagtggaattgcaggaaaaatctcgttgggaagttctgcaacaagaacaacggcta
atggaagagaaaaataaacgtaagaaagctctgctggctaaagctatcgcagaaagatct
aaaagaactcaggcagagactatgaaactaaagcggatccagaaagagttgcaggctttg
gatgacatggtatcagctgacattggaatccttaggaaccgcattgatcaggccagtctc
gactattcatatgcccggaagcggtttgacagggctgaggcagagtacattacagcaaag
ctggatttacagcgcaagactgagataaaagagcaactcactgagcatctctgtacgatc
atacagcagaatgagcttcggaaggccaagaagttggaggagttgatgcaacagctggac
gtacaagctgatgaggagactttggagcttgaggtggaagtagaaagacttcttcatgaa
caagaagcagaagcaaggagacaaatggctcatttagagaggccgtttcagcctgccggg
gacagtgtgacaacaggatttgctgatgaaaataaaaagtatcaagaacaagctgtttcc
ctaaagatagatgaacagtgtgaaaattctaagagcattcttcttcctagtctaggctgc
ccaaatcaagaagttaatggcatttcagctgatggaaccacgtga

DBGET integrated database retrieval system