KEGG   Oryctolagus cuniculus (rabbit): 100346627
Entry
100346627         CDS       T03373                                 

Gene name
WDR82, WDR82P1
Definition
(RefSeq) WD repeat domain 82
  KO
K14962  COMPASS component SWD2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100346627 (WDR82)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100346627 (WDR82)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100346627 (WDR82)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     100346627 (WDR82)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Histone modification proteins
   HMT complexes
    COMPASS/SET1 complex
     100346627 (WDR82)
    COMPASS/SET1 complex (yeast)
     100346627 (WDR82)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 MinC_C
Other DBs
NCBI-GeneID: 100346627
NCBI-ProteinID: XP_002713282
Ensembl: ENSOCUG00000008564
UniProt: G1SVE5
LinkDB
Position
9
AA seq 313 aa
MKLTDSVLRSFRVAKVFRENSDKINCFDFSPNGETVISSSDDDSIVLYDCQEGKPKRTLY
SKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHSKRVVALSMSPVDD
TFISGSLDKTIRLWDLRSPNCQGLMHLQGKPVCSFDPEGLIFAAGVNSEMVKLYDLRSFD
KGPFATFKMQYDRTCEWTGLKFSNDGKLILISTNGSFIRLIDAFKGVVMHTFGGYANSKA
VTLEASFTPDSQFIMIGSEDGKIHVWNGESGIKVAVLDGKHTGPITCLQFNPKFMTFASA
CSNMAFWLPTIDD
NT seq 942 nt   +upstreamnt  +downstreamnt
atgaagctgaccgacagcgtgctgcggagcttccgcgtcgccaaggtgttccgcgagaac
tccgacaagattaactgctttgacttcagccccaacggcgagacggtgatctcgagcagc
gacgacgactccatcgtgctctatgactgccaggagggcaaaccaaagagaaccttgtac
agtaagaaatatggcgtggatctcatcagatatactcatgcagcaaacacagttgtttac
agctcaaacaaaatagacgatactattcgttacctgtcattgcatgacaacaaatatatc
agatactttcctggacatagcaaaagggtggtggccttgtctatgtcacctgtggatgac
actttcatttctgggtctcttgataagaccattcgactctgggatctccggtctcctaac
tgccagggtctgatgcatctacagggcaaaccagtttgttcttttgacccagaagggttg
atttttgctgcaggtgtcaactctgaaatggttaaactttatgatcttcgctcttttgat
aaggggccatttgcaacctttaagatgcagtacgatcggacttgtgaatggacaggactt
aagttcagcaatgatggcaagctcattcttatctccaccaatggcagcttcatccgtctc
attgatgcattcaagggagtggtgatgcacacatttgggggttatgccaacagcaaagct
gtcacgctggaggcttcatttactcctgactctcagtttattatgattggttcagaggat
ggcaagatccatgtttggaatggagaaagtggtataaaagttgctgtgttggatggtaaa
cacacaggccccatcacctgtttgcagttcaaccccaagttcatgacctttgccagcgca
tgttccaacatggctttctggttgcccaccattgatgactga

DBGET integrated database retrieval system