KEGG   Oryctolagus cuniculus (rabbit): 100346821
Entry
100346821         CDS       T03373                                 

Gene name
CPSF2
Definition
(RefSeq) cleavage and polyadenylation specific factor 2
  KO
K14402  cleavage and polyadenylation specificity factor subunit 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100346821 (CPSF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100346821 (CPSF2)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     100346821 (CPSF2)
SSDB
Motif
Pfam: Lactamase_B_6 CPSF100_C Beta-Casp RMMBL Lactamase_B Lactamase_B_2 Beta_lactamase3
Other DBs
NCBI-GeneID: 100346821
NCBI-ProteinID: XP_017204845
Ensembl: ENSOCUG00000005713
UniProt: G1SPH7
LinkDB
Position
20
AA seq 782 aa
MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL
SHPDPLHLGALPYAVGKLGLNCAIYATIPVYKMGQMFMYDLYQSRHNTEDFTLFTLDDVD
AAFDKIQQLKFSQIVNLKGKGHGLSITPLPAGHMIGGTIWKIVKDGEEEIVYAVDFNHKR
EIHLNGCSLEMLSRPSLLITDSFNATYVQPRRKQRDEQLLTNVLETLRGDGNVLIAVDTA
GRVLELAQLLDQIWRTKDAGLGVYSLALLNNVSYNVVEFSKSQVEWMSDKLMRCFEDKRN
NPFQFRHLSLCHGLSDLARVPSPKVVLASQPDLECGFSRDLFIQWCQDPKNSIILTYRTT
PGTLARFLIDNPSEKVTEIELRKRVKLEGKELEEYLEKEKLKKEAAKKLEQSKEADIDSS
DESDVEEDIDQPSAHKMKHDLMMKGEGSRKGSFFKQAKKSYPMFPAPEERIKWDEYGEII
KPEDFLVPELQATEEEKSKLESGLTNGDEPMDQDLSDVPTKCISTTESIEIKARVTYIDY
EGRSDGDSIKKIINQMKPRQLIIVHGPPEASQDLAECCRAFGGKDIKVYMPKLHETVDAT
SETHIYQVRLKDSLVSSLQFCKAKDAELAWIDGVLDMRVSKVDTGVILEEGELKDDGEDA
EMQVDAPSDSSVIAQQKAMKSLFGDDEKEAGEESEIIPTLEPLPPHEVPGHQSVFMNEPR
LSDFKQVLLREGIQAEFVGGVLVCNNQVAVRRTETGRIGLEGCLCQDFYRIRDLLYEQYA
IV
NT seq 2349 nt   +upstreamnt  +downstreamnt
atgacatctattatcaaattaactaccctctctggggtccaagaagagtctgctctttgc
tatcttctccaagttgatgagttcagatttttgctggactgtggctgggatgaacacttc
tcgatggatattatagattccttgaggaagcacgttcaccagatcgacgcggtgctgctg
tcccacccggatcctctgcatctcggggccctcccatatgctgtgggcaagctggggctg
aactgcgccatctacgccaccatccctgtgtataaaatgggacagatgttcatgtatgat
ctctaccagtctcggcacaataccgaagattttacgctttttacgttagatgatgtggat
gcagcctttgacaaaatacagcagctaaaattctctcagattgtgaatttgaaaggtaaa
ggacatggtttgtctatcacacctctgccagccggtcatatgataggtggaacaatatgg
aaaatagtcaaagatggagaggaggagattgtgtatgctgttgacttcaaccacaagagg
gagatccacttaaatggatgctccctggaaatgctaagcagaccctccctacttatcaca
gattcgtttaatgctacgtatgtgcagcccagaagaaaacagagagatgagcagcttctg
acgaatgtcctggaaacgctgcgaggtgatggaaatgtgttaatagcagtggatactgca
ggccgggttttggagcttgctcagctccttgatcagatttggagaactaaagacgcaggc
ttgggtgtttactcactggcactcctaaataatgtcagttataacgtggtggagttttct
aagtcccaggtagaatggatgagtgacaaattgatgagatgttttgaagacaaaagaaat
aatccatttcagtttcgccatctttctttatgccatggtctttctgacttggcgcgagtt
cctagccccaaagttgtgcttgccagccagcccgacttggagtgtggattctcaagggat
ctctttattcagtggtgtcaggaccctaagaactcaatcattctaacttacagaaccact
cctggcaccttagcgcgtttcctaattgacaatccttctgaaaaagttacagaaatagag
ttgcggaaacgcgtgaagcttgaagggaaagaacttgaagaatacttggagaaagagaaa
ctaaagaaggaagctgctaaaaagcttgagcaatccaaagaggcggacatagactccagt
gacgagagtgacgtggaggaggacatcgaccagccgtcggctcacaagatgaagcacgac
ctgatgatgaagggggagggcagtcggaaaggaagtttcttcaaacaggcaaagaagtcc
taccccatgttccctgctcccgaggagagaattaagtgggatgagtatggcgaaattatc
aaaccagaggatttcttagtgccagaacttcaagctactgaggaagagaaaagcaaatta
gaatctggtctgacaaatggagacgaacccatggatcaggacttgtctgatgttcctact
aagtgtatttccacaacagagtccattgaaataaaagccagagtcacctacatagactac
gaaggccgctctgacggggattccatcaagaaaatcattaaccagatgaagccccggcag
ctcatcatcgtccatgggcccccggaggccagccaggacctggccgagtgctgccgcgcg
tttggcgggaaggacatcaaagtgtacatgccgaagctccatgaaaccgtggatgccacc
agtgagacacacatctaccaggtgaggttaaaagactccctcgtcagctcccttcagttt
tgtaaggccaaagacgcggagttggcctggatagacggtgtgctggacatgagagtctcc
aaggtggacacgggagttattttggaagaaggggagctgaaggacgacggagaggacgct
gagatgcaggtggacgccccttccgactcgagcgtgatcgcgcagcagaaggccatgaag
agcctgttcggggatgacgagaaggaggcgggggaggagagtgagatcatccccactttg
gagcccctgccgccgcacgaggttccaggacatcagtcagttttcatgaatgaaccaagg
ctctcagacttcaagcaagtccttttacgggagggaattcaagcggagtttgtcggaggt
gtacttgtttgcaacaaccaagtagcagtccgaagaacggaaactggacgcattggacta
gaaggctgcctttgtcaagacttctataggataagagaccttttgtacgaacagtacgcc
atcgtgtga

DBGET integrated database retrieval system