KEGG   Oryctolagus cuniculus (rabbit): 100346984
Entry
100346984         CDS       T03373                                 

Gene name
ADAR
Definition
(RefSeq) adenosine deaminase, RNA specific
  KO
K12968  double-stranded RNA-specific adenosine deaminase [EC:3.5.4.37]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu05162  Measles
ocu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    100346984 (ADAR)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    100346984 (ADAR)
   05164 Influenza A
    100346984 (ADAR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ocu03041]
    100346984 (ADAR)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.37  double-stranded RNA adenine deaminase
     100346984 (ADAR)
Spliceosome [BR:ocu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    100346984 (ADAR)
SSDB
Motif
Pfam: A_deamin z-alpha dsrm DND1_DSRM HTH_15 RPA_C Rrf2 FAM104
Other DBs
NCBI-GeneID: 100346984
NCBI-ProteinID: XP_008262595
Ensembl: ENSOCUG00000008544
LinkDB
Position
13
AA seq 1156 aa
MDPRQGYPLHRYHPRQAPGYEYSKLTYQQRDSGSAIHCFRLQQIGFLKGLLPEVPLTGKQ
TQSLPPFPPGLWPRFPGLPARDRQPEIWGVPRDVPIRRRGLQRGLQHSSPRGRALPCKGV
DGLASHFQDLSINQDQEQRILGLLEELREGEAVSAKYLAGKLRVPKKGVNQALYSLAKRG
KLRQKEGNPPLWSLAVSVPAENQHSTAGLELAQEDPDHCSQGTAKSDHSLEAEDRNLTSG
LEDSPEPLDMAEIKEKICNYLFKVSNSSALNVAKNIGFSKARDVNAVLIDLERQGDVYRQ
GATPPIWYLTDKKRERMQIKRNTNSVAETAPAAVPATKRNTELPACNLPRSDASNNMVTE
KVENGQEPAIKLESRQEARPEPARPKPPVYHNGPSKAGYVDFENGQWATDDIPDNLNSIH
AAPGEFRAIMEMPSFYSHGLPRCSPYKKLTECQLKNPISGLLEYAQFASQTCEFNLIEQS
GPPHEPRFKFQVVISGREFPPAEAGSKKVAKQDAAMKAMTILLQEAKAKDSGKSEDSSCS
SAEKNSEKAAEPQPSAPSAVPLFSGKSPVTTLLECVHKLGSSCEFRLLSKEGPAHDPKFQ
YCVAVGSQTFPTASAPSKKVAKQMAAEEAMKALQEEAANPTASDDQSGGSNTESLEALES
GLPSKVRKVGELVRYLNTNPVGGLLEYARSHGFAAEFKLVDQSGPPHEPKFVYQAKVGGR
WFPAVCAHSKKQGKQEAADAALRVLIGENEKAERMGFTELPLTGSTFHDQIAMLSHRCFN
ALTNSFQPSLLGRKILAAIIMKKDSDDMGVVVSLGTGNRCVKGDSLSLKGETVNDCHAEI
ISRRGFIRFLYSELMKYNPQTAKESIFEPARGGEKLQIKKTVSFHLYISTAPCGDGALFD
KSCSDRNVESTDSRHYPVFENPKQGKLRTKVENGEGTIPVESSDIVPTWDGIRLGERLRT
MSCSDKILRWNVLGLQGALLTHFLQPVYLKSVTLGYLFSQGHLTRAICCRMTRDGSAFEE
GLRKPFIVNHPKVGRVSVYDSKRQSGKTKETSVNWCLADGYELEILDGTRGTVDGPRNEL
SRVSKKSIFLLFKKLCSFRYRRDLLKLSYGEAKKAARDYETAKNYFKKSLKDMGYGNWIS
KPQEEKNFYLCPVPSD
NT seq 3471 nt   +upstreamnt  +downstreamnt
atggacccgcggcaggggtatcccctccacagatatcacccgcgtcaggctccaggttat
gagtacagcaagctcacttaccagcagcgggactcaggatctgccattcattgtttccga
ctccagcaaatagggtttctcaagggattgctcccggaagtgcccttgactggaaagcag
acacagtcactgccgccattccccccaggactctggccaagatttccaggactacctgcc
agagacaggcagccggagatctggggtgtccccagggacgtgcccatcagaaggaggggg
ctccagagagggctccagcactcttcgccgcgtggcagggctctgccatgcaaaggtgtt
gacgggcttgcctcacatttccaggatctcagtatcaaccaggatcaggagcagaggatc
ttagggctcttggaggagctcagggaaggggaggctgtctcagcaaaatatctggctggg
aagctccgagtcccaaagaagggagtcaatcaagctctgtactccctggcaaagaggggt
aagctgcgccagaaggaaggaaacccccctctgtggagcctcgcggtttcagttccggca
gaaaaccagcacagcacagcaggcttggaactagcgcaagaggatccagatcactgtagc
cagggaaccgcaaagtcagaccacagtttggaagctgaagatagaaacctcacatctggc
ttagaagactctcctgagcctctggacatggctgagatcaaggagaaaatctgcaactac
ttgttcaaagtgtctaactcctctgccctaaatgtggctaaaaatattggcttcagcaag
gcccgagatgtaaatgcggtgctgattgatttggaaaggcagggggatgtctacaggcag
ggtgcaacccctcccatatggtatctgacagacaagaagcgagagaggatgcagatcaag
agaaacacaaacagcgtcgccgaaaccgctccagctgccgtccctgccaccaaaagaaac
acagagctccccgcttgcaacttacccaggtccgatgcctcgaataacatggtcacagaa
aaagtggagaatgggcaggagcctgccataaagttagagagtaggcaagaggccaggcca
gaaccagcgaggccaaaaccgcccgtttatcacaatggcccctccaaagcagggtatgtt
gactttgaaaatggccagtgggccacagatgacatcccagataatttgaatagtatccac
gcagcgccaggtgagtttcgagccatcatggagatgccctccttctacagtcatggcttg
ccacggtgttcaccctacaagaaactgacagagtgccagctgaagaaccccatcagtggg
ctgttagagtatgcccagtttgccagtcagacctgtgagttcaacctgatagaacagagt
ggaccaccccacgaacctcggtttaaattccaggttgtcatcagtggccgagagttcccc
ccagctgaggctggcagcaagaaagtggccaagcaggatgcagccatgaaagccatgact
attctgcttcaagaagccaaagccaaagacagtgggaaatcagaagactcgtcctgctct
tccgcggagaaaaactcggagaaggctgcagagcctcagcccagtgctccttcagcagtg
cccctgttttctggaaagagtcctgtcactacgttgcttgagtgtgtgcacaagctgggg
agctcctgtgaattccgtctcctgtctaaagaaggccctgcccatgaccccaagttccag
tactgtgttgcagtgggttcccagacttttcccactgcaagtgcccccagcaagaaagtg
gcaaagcagatggcggcagaggaagccatgaaggccctgcaggaggaggcagccaacccc
acagcctctgatgaccagtccggcggttcaaacacagagtcccttgaggccttggagtct
ggcctgcccagcaaagtgcggaaggttggggagctcgtcaggtacctgaacaccaacccc
gtgggcggcctgctggaatacgcccgctcccacggctttgctgctgagttcaagttggtt
gaccagtccggacctcctcatgagcccaagtttgtttaccaagcaaaagttggaggtcgc
tggttcccagccgtctgcgcacacagcaagaagcaaggcaaacaggaagcagcagatgcg
gctctccgtgtcttgattggggagaacgagaaggcagaacgcatgggtttcacagagctt
cctctcaccggcagcacgttccacgaccagatcgccatgctgagtcaccggtgcttcaac
gctctcaccaacagtttccagccctccctgctgggccgcaagatcctggctgccatcatt
atgaagaaggactccgatgacatgggcgtcgtcgtcagcttggggactgggaatcgctgt
gtgaaaggagactctctcagcctgaagggagagacggtcaatgactgccacgccgaaatc
atctcccggagaggcttcatcaggtttctctacagcgagttaatgaagtacaacccccag
actgcgaaggaaagtatatttgagcctgctaggggaggagaaaagctccagataaaaaag
actgtttcatttcatctctatatcagcactgctccctgtggagacggcgcgctctttgac
aagtcctgcagtgaccgtaatgtggagagtacagattctcgccactacccggtcttcgag
aatcccaagcaaggcaagctacgcaccaaggtggagaatggagaaggcactatccctgtg
gaatccagtgacattgtgcccacgtgggatggcatccgacttggggagaggctccgaacc
atgtcttgtagtgacaaaatcctgcgctggaatgtgctgggcctgcagggagccctgctg
acccacttcctgcagcccgtgtatctcaagtctgtcacacttggttaccttttcagccaa
gggcacctgacccgcgccatctgctgccgtatgacaagagatggaagtgcatttgaggag
ggactgcggaagccctttatcgtcaaccatcccaaggttggccgagtcagtgtctatgac
tccaaaaggcagtccggcaagaccaaggagacgagcgtcaactggtgtctggctgatggc
tacgagctagagatcctggacggaaccagaggcaccgtggacgggccacggaatgaactg
tcccgggtctccaaaaagagtatttttcttctatttaagaagctctgctccttccgctac
cgcagagatttactgaaactctcctatggtgaggccaagaaagctgcccgtgactatgag
acggccaagaactacttcaaaaagagcctgaaggacatgggctatgggaactggataagc
aagccccaggaggaaaagaacttttacctctgcccggtacccagtgactga

DBGET integrated database retrieval system