KEGG   Oryctolagus cuniculus (rabbit): 100347269
Entry
100347269         CDS       T03373                                 

Gene name
BRCA1
Definition
(RefSeq) BRCA1, DNA repair associated
  KO
K10605  breast cancer type 1 susceptibility protein [EC:2.3.2.27]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu03440  Homologous recombination
ocu03460  Fanconi anemia pathway
ocu04120  Ubiquitin mediated proteolysis
ocu04151  PI3K-Akt signaling pathway
ocu05206  MicroRNAs in cancer
ocu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100347269 (BRCA1)
  09124 Replication and repair
   03440 Homologous recombination
    100347269 (BRCA1)
   03460 Fanconi anemia pathway
    100347269 (BRCA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100347269 (BRCA1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100347269 (BRCA1)
  09162 Cancer: specific types
   05224 Breast cancer
    100347269 (BRCA1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100347269 (BRCA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100347269 (BRCA1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100347269 (BRCA1)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100347269 (BRCA1)
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100347269 (BRCA1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100347269 (BRCA1)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100347269 (BRCA1)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100347269 (BRCA1)
  Multi subunit Ring-finger type E3
   BRCC complex
    100347269 (BRCA1)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     100347269 (BRCA1)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-core complex
     100347269 (BRCA1)
    BRCA1-A complex
     100347269 (BRCA1)
    BRCA1-B complex
     100347269 (BRCA1)
    BRCA1-C complex
     100347269 (BRCA1)
    BRCA complex
     100347269 (BRCA1)
   FA (Fanconi anemia) pathway
    Downstream FA components
     100347269 (BRCA1)
SSDB
Motif
Pfam: BRCT_assoc BRCT zf-C3HC4 zf-C3HC4_2 zf-C3HC4_4 zf-C3HC4_3 zf-RING_2 zf-RING_UBOX zf-RING_5 zf-Nse zf-RING_6 BRCT_2 zf-ANAPC11 zf-RING_10 Prok-RING_4 zf-rbx1
Other DBs
NCBI-GeneID: 100347269
NCBI-ProteinID: XP_008269770
Ensembl: ENSOCUG00000003883
UniProt: G1SKM1
LinkDB
Position
19
AA seq 1852 aa
MDLSGVRVEEVQNVLNAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQ
CPLCKNDITKRSLQESTRFSQLVEELLKMIQAFELDTGLPFANSYDFSKKKNNSPEHQKE
DVSIIQSIGYRNRAKGLRKIEPKNPTLETSLSVQVSDLGIVRSLRTTHQIQPQNKSVYIE
LGSDSSEETVNKANYYSLGNEEFLQSTLQGANAEATLDPAKKAACVFSEKEITNIEPHQS
NNKDLTTVKKHATERHPEKYQGISISNLHVEPCGTDTHASSLQHENSSLLLTKDRMNVEK
AEFCNKSKQPGLARSQQSRWAESKETCNDRQTPSTEKKVVPNVDCLYGRKQQDKQKPSCP
ETSGDNQDVSWITVNSSIQKVNEWFSRSNEMLTPDDSLDRRSESNAKVTGALEVPKEIDG
YSGSTEKIDLLASESHNALICENKRVHSKPVENNIKDKIFGKTYHRKTSLPNLSHITEDL
TIGAFAAEPLVPCPPANKLKRKRRTSSGLQPEDFIKKVDLAVVPKTPAQINQGTDQTVDN
DQEMNITNRGNENETKGDYVQKETNANPTESLEKESSFRTKVEPISSSISNMELELNVHN
SKKPKKNRLRKKSSTRRVHALELVVNKKPSPPNHTELQIDSCTSSEEMNFDQIPVSHSRQ
VQVIEDTEPPTGARKNKPNEQISKRHASDVFPEVKLTSIPGVFTNCSSSNKLQESVNPSL
QRREIEENLDTVQVPNSALDPKDLLLCGERGLQTERSVESTSISLVPDTEYGTQDSISLL
GANTLGKAKTAANGHVSESTAIGNPKELIRDCLKDTGNDPDKCKDPLRSEVDQETSVAME
ESEFDTQYLQNTFMGSKRRSFALCSKPGDPEKECAAVCTRSNSSRKQSPEVTLEREQKEE
SQRKEEWKISHVQAADSTVGFPVVCQKEKAGDCAKWGIKEISRLCLSSQSKGSETELIAV
SKHGMSQNPYHMPPISPIKPSVKATRQVNLSGQRSEEHSVSSERAVGSESLIPSTVSTIS
QEYIRESALKGFSSSSINEGGSSANEVCSSVNEVGSSGENMQAQPGRSRAPELNAVLRLG
LMQPEVCEQSLPVSNSELPKLQRQEENKGVVQAVNRDFSSYLVPDSQEQSIGGRHASQIC
SETPDDLLDIYEIKENTSFAESGIKERSAVFSKSVPRGECSRTPSPSGHACLAQSHQREA
RKLESSEEHIPSEDEELICFQQLLFGKVTDRPSQSTRRSAVATECVSEKTEENFVSLKNS
LNDSDNEVTLSKASQEHPPSQGSECSGSLFSSQCSAVEDLNENTNSQDPFLMFDSPSKQM
RHQSESQQDTSDKELASDDEDNLQGQNVDANLGAAASGCESEASLSGVHSGLSSQSEILT
TQQRDTMQDNLLKLQEEMAQLEAVLEQNGSQPSYRPPSPLPDPCASEDPLNLQQNTPEKG
VLTSEKSSEYPISRNPKSLSVDKFRESPHHSNSKNKEPGAGRTSPSESQLFGNRWYTHSH
SSALRNKSCPPQEESVKEVGLEQRQLEDSEPQDSVSESYLPTQDTEGTPYLESGISLFSD
PESAPAEDRAPGPAPVCSSPDSRSTLKLPQFQVAESVQSPANDSAGCSSKEESLSLDKPE
SISSTERINKGISMVVSGLTPKEFMLVHKFARKYHITLTNVITEETTHVIMKTDAEFVCE
RTLKYFLGIAGGKWVVSYFWVTQSIKERKILDEHDFEVRGDVVNGRNHQGPKRARESQDR
KIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVRELSSFTRGTGVHPIVVVQPDAWTED
GGFHGIGQMCAASVVSREWVLDSIALYQCQELDPYLIPQSPAAAAEHSRPRV
NT seq 5559 nt   +upstreamnt  +downstreamnt
atggatttgtctggagttcgtgttgaagaagtacaaaatgtccttaatgctatgcagaaa
atcttagagtgtccaatctgtctggaattgattaaagaacctgtttctacaaaatgtgac
catatattttgcaaattttgtatgctgaagcttctcaaccagaagaaagggccctcacaa
tgtcctttgtgtaagaatgatataaccaaaagaagccttcaagagagtacaagatttagt
caacttgttgaagagctattgaaaatgattcaggcttttgagcttgacacaggattgccc
tttgcaaacagttatgacttttcaaaaaagaaaaacaactctcctgaacatcaaaaggag
gacgtttctatcattcaaagtataggctaccgaaaccgtgccaaagggcttcgaaagatt
gaacccaaaaatcctacgttggaaaccagtcttagtgtccaagtctctgaccttggaatt
gtgagatctctgaggacaacgcatcagatacagcctcaaaataagtctgtctacattgaa
ttgggatctgattcttctgaagaaacagttaataaggcgaattattacagtctgggaaat
gaagaatttttacaaagcactcttcaaggagccaatgctgaagccactttggatcctgca
aaaaaggctgcttgtgtgttttctgagaaggaaataacaaatattgaacctcatcaatcc
aataataaagatttgaccactgttaagaagcatgcaactgagaggcatccagaaaagtat
cagggtatttctatttcaaacttgcatgtggagccatgtggcacagatactcatgccagc
tcattacagcatgagaacagcagtttattactcactaaagacagaatgaatgtagaaaag
gctgaattctgtaataagagcaagcagcctggcttagcaagaagccaacagagcagatgg
gccgaaagtaaggaaacatgtaatgataggcagactcccagcacagagaaaaaggtagtt
ccgaatgttgattgcctgtatgggagaaaacaacaggataagcagaaaccttcgtgccct
gagacctctggagataaccaagatgtttcttggataacagtaaatagcagcattcagaaa
gttaacgagtggttctccagaagtaatgaaatgttaactcctgatgactcacttgaccgg
cggtctgagtcaaatgccaaagtgactggtgcattagaagttccaaaggagatagatgga
tattctggttctacagagaaaatagacttactggccagtgagtcccataatgctttaata
tgtgaaaataaaagagtccattccaaaccagtagagaataatatcaaagataaaatattc
gggaaaacctaccacaggaagacaagcctccctaacttgagccacataactgaagatcta
actataggagcgtttgctgcggaaccactggtaccgtgtccacccgcaaataaattaaaa
cgtaaaagaagaacttcttcaggccttcaacctgaagattttatcaagaaggtagatttg
gcagttgttccaaaaactcctgcacagataaatcagggaactgatcaaacggtggacaat
gatcaggagatgaatattactaatcgtggtaatgagaatgaaacaaaaggtgattatgtt
cagaaagagacaaatgctaacccaacagaatccctggaaaaagaatcttccttcagaact
aaagttgaacctataagcagcagtataagcaatatggaactagaattaaatgtccataat
tcaaaaaaacccaagaagaacaggctgaggaagaagtcctctaccaggcgtgttcatgca
cttgaactagtagtcaataagaaaccgagcccacctaatcatactgaactacaaattgat
agttgtactagcagtgaagaaatgaatttcgaccaaataccagtcagtcacagcagacag
gttcaagtcatagaagatacagaacctccaactggagctaggaagaacaagccaaatgaa
caaataagtaaaagacatgccagtgatgttttcccagaagtaaaattaacaagcatacct
ggtgtttttactaactgttcaagttctaataaacttcaagaatctgtcaatcctagcctt
caaagaagggaaatagaagagaacctagacacagttcaagtgcctaatagtgccctagac
cccaaagatctcctgttatgtggagaaaggggcttgcaaactgaaaggtctgtggagagt
accagtatttcactggtacctgatactgaatatggtactcaggacagcatctcattactg
ggcgctaacacccttggaaaggcaaaaacagcagcaaatggacatgtgagtgagagcaca
gcaattggaaatcccaaggaacttatccgtgattgtttgaaagatactggaaatgacccg
gacaaatgtaaggatccattgagaagtgaagttgaccaagagacaagcgtagcaatggaa
gagagtgagtttgatactcagtatttacagaatacattcatgggttccaagcgtcgttca
tttgctctgtgttcaaaaccaggagatccagaaaaggaatgtgcagcagtctgtacccgc
tccaactcctcaaggaaacaaagtccagaagtcactcttgaacgtgaacaaaaagaagaa
agtcagagaaaggaagagtggaaaatcagtcatgtccaggcagccgatagcactgtgggc
tttcctgtggtgtgtcagaaagagaaggcaggtgattgtgccaaatggggcattaaagag
atctctaggctttgtctgtcatctcagtccaaaggcagtgaaactgagctcattgctgta
agtaaacatggaatgtcacaaaacccatatcatatgccaccaatttctcccatcaagcca
tctgttaaagccacacgtcaggtaaacctgtcagggcaaaggtctgaggaacattccgtg
tcatctgaaagagcagtgggaagcgagagcctcattccaagcacagtgagcacaattagc
caagagtacattagagaaagtgctttgaaaggattcagctcgagcagtattaatgaaggg
ggctctagtgctaacgaagtatgctccagtgttaatgaagtaggatccagtggtgaaaac
atgcaagcacaaccaggcagaagcagagcacctgagttaaatgctgtgcttagactaggt
cttatgcagcctgaagtctgtgagcaaagtcttcctgtaagtaattctgaacttcccaaa
ctccaaaggcaagaagaaaacaaaggagtagttcaggctgtgaatagagatttctcttcg
tatctggttcctgatagccaagagcagtctataggaggtaggcatgcttctcagatttgt
tctgagacacctgatgacctgttagatatttatgaaataaaggaaaataccagctttgct
gagagcggcattaaggaaagatctgctgtgtttagtaaaagtgttccgaggggagagtgc
agtagaacccctagcccttcaggccatgcatgtttggctcagagtcaccaaagagaagct
aggaaattagagtcctcagaagagcatatacctagtgaggatgaagagcttatctgtttc
caacaattactgtttggtaaagtaactgatagaccatcccaatctactaggcgtagtgct
gttgccacagagtgtgtatctgagaaaacagaggagaacttcgtgtcattgaaaaatagc
ttaaacgactctgataacgaggtgacactgtcaaaggcatcccaggagcacccccccagc
cagggatcagaatgttccggtagcttgttttcttcccagtgcagtgcagtggaagacttg
aatgaaaatacaaactcccaggatcccttcttgatgtttgattctccttccaaacaaatg
agacatcagtctgaaagccagcaagatacgagtgacaaggaattggcttcagatgatgaa
gataatctccaaggacagaatgtggatgcaaacttaggtgcagcagcatctgggtgtgag
agtgaagcaagtctgtctggagtccactcagggctgtcctctcagagcgaaatcttaacc
actcagcagagggacaccatgcaagataaccttctaaaactccaggaggaaatggctcag
ctggaagctgtgttagagcagaatgggagccagccctcttacagacccccttcccccctg
cctgacccatgtgcctcggaggacccgctaaatctacaacagaacacaccagaaaaagga
gtattaacttcagagaaaagtagtgaatatcctatcagccggaatccaaaaagcctttct
gttgacaagttccgggaatctccacatcattccaacagtaaaaataaagaaccaggagca
ggaaggacttccccttctgaatcccagttgttcgggaatagatggtacacgcacagccat
tcgagcgctcttcggaacaaaagctgcccacctcaagaggagtccgttaaggaagttggt
ttggagcagcggcagctggaagactctgagccgcaagattcagtgtcagagtcttatttg
ccaacacaagatacagagggcaccccttacttggaatctggaatcagcctcttctctgac
cctgaatctgctcctgctgaggacagagcccccgggccagctcctgtgtgcagctcacca
gattcacgatctacactgaagttaccccaatttcaggttgcagaatctgtccagagtcca
gctaacgatagtgctggatgcagttccaaggaagaaagtttaagcttggataagccagaa
tcaatatcctcaacagaaaggatcaacaagggaatatccatggtggtatcaggcttgacc
ccaaaagaatttatgcttgtgcacaagtttgccagaaaataccacatcactttaactaat
gtaattactgaagagactactcatgtcattatgaaaacagatgctgaatttgtgtgtgaa
cggacactgaaatattttctggggattgcaggaggaaagtgggtagttagctatttctgg
gtgacccagtcaattaaagaaagaaagatactggatgagcatgattttgaagtcagaggt
gatgtcgtcaacggaagaaaccaccagggtccaaagcgagcgagagaatcccaggacaga
aagatcttcaggggcttagaaatctgttgctatgggccctttaccaacatgcccacagat
caactggagtggatggtacagctctgtggcgcctccgtggtgagggagctttcgtcattc
acccgtggcacaggagttcacccgattgtggtcgtgcagccagatgcctggacggaggac
ggtggcttccatgggattggacagatgtgtgcggcatccgtggtgagcagagagtgggtg
ttggacagcatagccctgtatcagtgccaggagctggacccctacctgataccacagagc
cccgcagcagctgctgagcacagccggccacgtgtctag

DBGET integrated database retrieval system