KEGG   Oryctolagus cuniculus (rabbit): 100347407
Entry
100347407         CDS       T03373                                 

Gene name
RAF1
Definition
(RefSeq) Raf-1 proto-oncogene, serine/threonine kinase
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu01522  Endocrine resistance
ocu04010  MAPK signaling pathway
ocu04012  ErbB signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04024  cAMP signaling pathway
ocu04062  Chemokine signaling pathway
ocu04068  FoxO signaling pathway
ocu04071  Sphingolipid signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04140  Autophagy - animal
ocu04150  mTOR signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04210  Apoptosis
ocu04218  Cellular senescence
ocu04270  Vascular smooth muscle contraction
ocu04360  Axon guidance
ocu04370  VEGF signaling pathway
ocu04371  Apelin signaling pathway
ocu04510  Focal adhesion
ocu04540  Gap junction
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04625  C-type lectin receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04660  T cell receptor signaling pathway
ocu04662  B cell receptor signaling pathway
ocu04664  Fc epsilon RI signaling pathway
ocu04666  Fc gamma R-mediated phagocytosis
ocu04720  Long-term potentiation
ocu04722  Neurotrophin signaling pathway
ocu04726  Serotonergic synapse
ocu04730  Long-term depression
ocu04810  Regulation of actin cytoskeleton
ocu04910  Insulin signaling pathway
ocu04912  GnRH signaling pathway
ocu04914  Progesterone-mediated oocyte maturation
ocu04915  Estrogen signaling pathway
ocu04916  Melanogenesis
ocu04917  Prolactin signaling pathway
ocu04919  Thyroid hormone signaling pathway
ocu04921  Oxytocin signaling pathway
ocu04926  Relaxin signaling pathway
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04929  GnRH secretion
ocu04935  Growth hormone synthesis, secretion and action
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05034  Alcoholism
ocu05132  Salmonella infection
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05206  MicroRNAs in cancer
ocu05210  Colorectal cancer
ocu05211  Renal cell carcinoma
ocu05212  Pancreatic cancer
ocu05213  Endometrial cancer
ocu05214  Glioma
ocu05215  Prostate cancer
ocu05218  Melanoma
ocu05219  Bladder cancer
ocu05220  Chronic myeloid leukemia
ocu05221  Acute myeloid leukemia
ocu05223  Non-small cell lung cancer
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05230  Central carbon metabolism in cancer
ocu05231  Choline metabolism in cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100347407 (RAF1)
   04012 ErbB signaling pathway
    100347407 (RAF1)
   04014 Ras signaling pathway
    100347407 (RAF1)
   04015 Rap1 signaling pathway
    100347407 (RAF1)
   04370 VEGF signaling pathway
    100347407 (RAF1)
   04371 Apelin signaling pathway
    100347407 (RAF1)
   04630 JAK-STAT signaling pathway
    100347407 (RAF1)
   04068 FoxO signaling pathway
    100347407 (RAF1)
   04072 Phospholipase D signaling pathway
    100347407 (RAF1)
   04071 Sphingolipid signaling pathway
    100347407 (RAF1)
   04024 cAMP signaling pathway
    100347407 (RAF1)
   04022 cGMP-PKG signaling pathway
    100347407 (RAF1)
   04151 PI3K-Akt signaling pathway
    100347407 (RAF1)
   04150 mTOR signaling pathway
    100347407 (RAF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100347407 (RAF1)
  09143 Cell growth and death
   04210 Apoptosis
    100347407 (RAF1)
   04218 Cellular senescence
    100347407 (RAF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100347407 (RAF1)
   04540 Gap junction
    100347407 (RAF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100347407 (RAF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100347407 (RAF1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100347407 (RAF1)
   04650 Natural killer cell mediated cytotoxicity
    100347407 (RAF1)
   04660 T cell receptor signaling pathway
    100347407 (RAF1)
   04662 B cell receptor signaling pathway
    100347407 (RAF1)
   04664 Fc epsilon RI signaling pathway
    100347407 (RAF1)
   04666 Fc gamma R-mediated phagocytosis
    100347407 (RAF1)
   04062 Chemokine signaling pathway
    100347407 (RAF1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100347407 (RAF1)
   04929 GnRH secretion
    100347407 (RAF1)
   04912 GnRH signaling pathway
    100347407 (RAF1)
   04915 Estrogen signaling pathway
    100347407 (RAF1)
   04914 Progesterone-mediated oocyte maturation
    100347407 (RAF1)
   04917 Prolactin signaling pathway
    100347407 (RAF1)
   04921 Oxytocin signaling pathway
    100347407 (RAF1)
   04926 Relaxin signaling pathway
    100347407 (RAF1)
   04935 Growth hormone synthesis, secretion and action
    100347407 (RAF1)
   04919 Thyroid hormone signaling pathway
    100347407 (RAF1)
   04928 Parathyroid hormone synthesis, secretion and action
    100347407 (RAF1)
   04916 Melanogenesis
    100347407 (RAF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100347407 (RAF1)
  09156 Nervous system
   04726 Serotonergic synapse
    100347407 (RAF1)
   04720 Long-term potentiation
    100347407 (RAF1)
   04730 Long-term depression
    100347407 (RAF1)
   04722 Neurotrophin signaling pathway
    100347407 (RAF1)
  09158 Development and regeneration
   04360 Axon guidance
    100347407 (RAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100347407 (RAF1)
   05206 MicroRNAs in cancer
    100347407 (RAF1)
   05205 Proteoglycans in cancer
    100347407 (RAF1)
   05230 Central carbon metabolism in cancer
    100347407 (RAF1)
   05231 Choline metabolism in cancer
    100347407 (RAF1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100347407 (RAF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100347407 (RAF1)
   05212 Pancreatic cancer
    100347407 (RAF1)
   05225 Hepatocellular carcinoma
    100347407 (RAF1)
   05226 Gastric cancer
    100347407 (RAF1)
   05214 Glioma
    100347407 (RAF1)
   05221 Acute myeloid leukemia
    100347407 (RAF1)
   05220 Chronic myeloid leukemia
    100347407 (RAF1)
   05218 Melanoma
    100347407 (RAF1)
   05211 Renal cell carcinoma
    100347407 (RAF1)
   05219 Bladder cancer
    100347407 (RAF1)
   05215 Prostate cancer
    100347407 (RAF1)
   05213 Endometrial cancer
    100347407 (RAF1)
   05224 Breast cancer
    100347407 (RAF1)
   05223 Non-small cell lung cancer
    100347407 (RAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100347407 (RAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    100347407 (RAF1)
  09165 Substance dependence
   05034 Alcoholism
    100347407 (RAF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100347407 (RAF1)
   05152 Tuberculosis
    100347407 (RAF1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100347407 (RAF1)
   05164 Influenza A
    100347407 (RAF1)
   05161 Hepatitis B
    100347407 (RAF1)
   05160 Hepatitis C
    100347407 (RAF1)
   05163 Human cytomegalovirus infection
    100347407 (RAF1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100347407 (RAF1)
   05165 Human papillomavirus infection
    100347407 (RAF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100347407 (RAF1)
   01522 Endocrine resistance
    100347407 (RAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100347407 (RAF1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100347407 (RAF1)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   100347407 (RAF1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2
Other DBs
NCBI-GeneID: 100347407
NCBI-ProteinID: XP_008258643
Ensembl: ENSOCUG00000014175
LinkDB
Position
9
AA seq 621 aa
MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDSSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSTIGDSGAPALPSLTMRRMRESVSRMPVSSQHRYSTPHAFTF
NTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIEDAIRSHSESGSPSALSSSPNNL
SPTGWSQPKTPVPAQRERAPGSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSF
GTVYKGKWHGDVAVKILKVVDPTPEQLQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIV
TQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGL
TVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYE
LMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCVKKVKEERPLFP
PDPVLHRAAPALSAEDQPERL
NT seq 1866 nt   +upstreamnt  +downstreamnt
atggagcacatacagggggcttggaagacgatcagcaatggttttggattcaaagatgca
gtgtttgatggctccagctgcatctcccccacgatagttcagcagtttggctatcagcgt
cgggcgtcagatgatggcaaactcacagattcttctaagacaagcaacactatccgtgtg
ttcttgccaaataagcaacgaacagtggtcaatgtgcgaaatgggatgagcttgcatgac
tgcctaatgaaagcgctcaaggtgaggggcctgcagccggagtgctgtgctgtgttcaga
ctcctccatgaacataaaggtaaaaaagcacgtttagattggaatacggatgccgcctcc
ttgattggagaagaacttcaagtagatttcctggatcacgttcccctcaccacacacaac
tttgcccgaaagacgttcctgaagcttgccttctgtgacatttgtcaaaagttcctcctc
aatggatttcgatgtcagacttgtggctacaaatttcatgagcactgtagcaccaaagta
cctactatgtgtgtcgactggagtaatatcagacagctcttattgtttccaaactccacc
attggtgatagtggggccccagcactaccttctttgacgatgcgtcggatgcgagaatct
gtttcccggatgcctgttagttcccagcacagatactccacaccccatgccttcacattc
aacacctccagtccctcctcagaaggctccctgtcccagaggcagaggtcgacgtccaca
cctaatgtccacatggtcagcaccaccctgcctgtggacagcaggatgattgaggatgca
attcgaagtcacagtgaatcaggctcaccttcagccctatccagcagccccaacaatttg
agcccaacaggctggtcacagcccaaaacccctgtgccagcacagagagaacgggcacca
ggatctggaacacaggagaaaaacaaaattaggccccgtggacagagagattccagctat
tactgggaaatagaagccagcgaagtgatgctctccactcggattggatctggctccttt
ggaactgtttataaaggcaaatggcatggagacgttgcagtgaagatccttaaggtcgtc
gacccaaccccagagcagctgcaggccttcaggaacgaggtggctgtcctgcgcaaaaca
cggcatgtgaacatcctactcttcatggggtacatgacaaaggacaacctggcaattgtg
acccagtggtgtgagggcagcagcctctataaacatctgcacgtccaggagaccaagttc
cagatgttccagttaattgacatcgcccgccagacagcacaaggcatggactacttgcat
gcaaagaatatcattcacagagacatgaaatccaacaatatattcctccatgaaggccta
acggtgaaaattggagatttcggtttggcaacagtaaaatcacggtggagtggttcccag
caggtcgaacaacctaccggctccgtcctgtggatggctccagaggtgatccgaatgcag
gataacaaccccttcagcttccagtctgacgtctactcgtacggcatcgtgttgtacgag
ctgatgacaggggagcttccctactcccacatcaacaaccgggatcagatcatcttcatg
gtgggccggggctatgcctccccggatctcagcaagctctacaagaactgcccgaaagcc
atgaagaggctggtggctgactgcgtgaagaaagttaaggaggagaggcctctttttccc
ccagatcctgtcctccatcgagctgctccagcactctctgccgaagatcaaccggagcgc
ctctga

DBGET integrated database retrieval system