KEGG   Oryctolagus cuniculus (rabbit): 100347631Help
Entry
100347631         CDS       T03373                                 

Gene name
RIBC2
Definition
(RefSeq) RIB43A domain with coiled-coils 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
SSDB OrthologParalogGFIT
Motif
Pfam: RIB43A
Motif
Other DBs
NCBI-GeneID: 100347631
NCBI-ProteinID: XP_002724051
Ensembl: ENSOCUG00000016652
LinkDB All DBs
Position
Un
AA seq 377 aa AA seqDB search
MEAAQPEDLAQEARLTKRRQAELCRQQRVFNARDRLIGGDTAAWDVQVRDQKIREATEKA
RHESFAAEMKQNDRLLCLLEARAGRDRRALCRAISEFQKNFQRPDTRREFDLSDPLALRK
ALPARQSDHDVRNTVSGMQKFLGEDLDFRERKKCQEEQSREWSLQQRREWEDARAEQKCA
EDLYTQTRLQFDETAKQLQNLQSATQKAVCAAVKDFNRTQALESAERKKQEKKQEQEDNL
AEISHLLRGDLLSENPRQAASSFGPHRVVPDRWKGMSQEQLEQIRLAQKQQVQEKLRLQE
EERQRDLDWDRRRVQGARAMLLLERQQQRQQRHLRRALDSSNLSLAQKQHLQRKSMNELY
RNQPTEEYFAQFNTRSR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggcgcagcccgaggacctggcgcaggaggcccgtctgaccaagaggcggcag
gcggagctgtgcaggcagcagcgggtcttcaacgccagagacaggctgatcgggggagac
accgcagcctgggacgttcaggttcgggaccagaagataagagaagccacggagaaagct
cgccatgaaagtttcgccgctgaaatgaagcagaatgaccgactcctgtgcctgttagaa
gcccgcgcggggagagaccggagagctctgtgcagggccatcagcgagttccagaagaac
ttccagcggccagacacccgccgtgaatttgacctgtccgacccgctggccctgcggaag
gccctcccggcccggcagtcggatcacgacgtccgcaacaccgtgtcgggcatgcagaag
ttcctgggcgaggacctggacttccgcgagaggaagaaatgccaagaggagcaaagcaga
gagtggtccctgcagcagcgacgggagtgggaggacgcccgggctgagcagaagtgcgca
gaggacctgtacacgcagacaaggctgcagtttgatgagacagccaagcagctgcagaat
ctgcaaagtgccacccaaaaggccgtctgcgcagccgtgaaagacttcaacaggacccag
gccctggagtcagcggaaaggaaaaagcaggagaagaaacaggagcaggaggacaacctg
gccgagatctcgcacctgctgcgcggggacctgctctccgagaacccgcgccaggcagcc
agctccttcgggccccaccgcgtggtccccgaccgctggaagggcatgagccaggagcag
ctggagcagatccgcctcgcccagaagcagcaagtccaggagaagctgaggctccaggaa
gaagaacgccagcgagacctagactgggaccggcggagggtccagggggctcgggccatg
ctgctgttggagcggcagcagcaacgccagcagcgccacctgcgcagggccctggacagc
agcaacctcagcctggcccagaagcagcatctgcagaggaaatctatgaacgagctgtac
aggaatcagcccacggaggagtatttcgcccagtttaacacaagaagccgctga

DBGET integrated database retrieval system