KEGG   Oryctolagus cuniculus (rabbit): 100347707
Entry
100347707         CDS       T03373                                 

Gene name
DDX58
Definition
(RefSeq) DExD/H-box helicase 58
  KO
K12646  ATP-dependent RNA helicase DDX58 [EC:3.6.4.13]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04064  NF-kappa B signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05164  Influenza A
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100347707 (DDX58)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100347707 (DDX58)
   04623 Cytosolic DNA-sensing pathway
    100347707 (DDX58)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    100347707 (DDX58)
   05164 Influenza A
    100347707 (DDX58)
   05161 Hepatitis B
    100347707 (DDX58)
   05160 Hepatitis C
    100347707 (DDX58)
   05168 Herpes simplex virus 1 infection
    100347707 (DDX58)
   05169 Epstein-Barr virus infection
    100347707 (DDX58)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:ocu04054]
    100347707 (DDX58)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     100347707 (DDX58)
Pattern recognition receptors [BR:ocu04054]
 Cytoplasmic pattern recognition receptors
  RIG-I-like receptors
   100347707 (DDX58)
SSDB
Motif
Pfam: CARD_2 RIG-I_C RIG-I_C-RD Helicase_C DEAD ResIII AAA_22 Syntaxin_2 ATP-synt_ab AAA_25
Other DBs
NCBI-GeneID: 100347707
NCBI-ProteinID: XP_002708086
Ensembl: ENSOCUG00000004710
UniProt: G1SMD2
LinkDB
Position
1
AA seq 926 aa
MTAEERRNLQAFSDYVKRILDPTHILSYMNSWLGEDEVQYIQAEKNNKGPMEAASLFLKY
LLQLKEEGWFRGFLDALNNAGYSGLYEAIANWNFQKIEKLEEYRALLKRLQPAFKDRIDP
TCILPEMSDCIISQEYEEIMQVCSNKGIMAGAEKMAECLLRSDKENWPKTLKLALDNDNN
SFSELWMVEEDAKDVEAEDLEEDDMGTSSIHIVYQEDPQLENLSQNSCTPAEVSRAKLCS
QLKPRNYQLELALPAMKGKNTIICAPTGCGKTFVSLLICEHHLKTFPQGQKGKVVFFANH
VPVYEQQKSVFSEYFERLGYSVAGIAGATVENVPVQQIVENNDIIVLTPQILVNNLKDGT
IPSLSVFTLMIFDECHNTCKQHPYNKIMFYYLDQKLGGSSDPLPQVVGMTASVGVGDAKN
TDEAVEYICKLCASLDASVIATVKENLEELQEIVYTPQKISRRVESRTTNGFKRIISQLM
RETESLAKDVFEELENLSQIQNREFGTQKYEQWIVEVHKACRTFQLPDKDEESRICKALY
LYTSHLRKYNDALIISEHAQMKDALNYLNNFFKDVRAAGFDETEQDLTRRFEGKVQELET
VSMDPSNENPKLKDLYLILQEEYHVNPETKTILFVKTRALVDAIKKWIEENSKLSFLKPG
ILTGRGKTSQTTGMTLPAQKCVLDAFRSNGDHNILIATSVADEGIDIAQCNLVILYEYVG
NVIKMIQTRGRGRAKGSKCLLLTSNADVIEKENINMYKEKMMNESILRLQTCDEAKFKKK
LLCIQTGEKIIRDNQQNFKPKLDKQNKKLLCAKCKALACYTSEIRMVKDSHYTVVGETFK
KCFVTRPHPRPKSCGDFDKIGKIFCARQDCSHDWGIRAKVNAFEIPLIKIQSFVVEDTVT
GKQMCPSKWKDFNFEKIPFNPEELSE
NT seq 2781 nt   +upstreamnt  +downstreamnt
atgaccgccgaggagcggaggaacctgcaagccttcagcgactatgtcaagaggattctg
gaccctacccacatcctgagctacatgaactcctggcttggggaggatgaagtgcagtat
attcaggctgagaaaaacaacaagggtccaatggaggctgcctcactttttctcaagtac
ctgctgcagctcaaggaagaaggctggttccgtggctttttggatgccctaaacaatgca
ggttattctgggctttatgaagccattgcaaattggaatttccaaaaaattgaaaagttg
gaggaatacagagcacttttgaaacgtttacaaccagcatttaaagacagaattgatcca
acatgtatccttcctgaaatgtctgactgtataattagtcaggaatatgaagaaattatg
caggtttgctccaataaggggataatggcaggtgcagagaaaatggctgaatgccttctc
agatcagacaaggaaaactggcccaaaactttaaaacttgctttggataatgataacaac
tcattcagtgaactttggatggtagaggaagatgccaaagatgttgaagctgaagatctt
gaggaggacgacatgggaacttccagcatacatattgtctaccaggaagatccacagttg
gagaatctcagtcagaattcatgtacacctgcagaagtatctcgcgctaaattatgcagc
caactgaaaccaagaaattaccagctagagcttgctctgcctgctatgaagggaaaaaac
acaataatatgtgctcctactggttgtggaaaaacctttgtttcacttcttatatgtgaa
catcatcttaaaacatttccacaaggacaaaaagggaaggtggtgttttttgctaatcac
gtccctgtgtatgaacagcagaaatctgtgttctcagagtattttgaaagacttgggtac
agtgtggcaggcattgctggagcaacagttgagaatgtccccgtgcaacaaatcgtggag
aacaatgacatcattgttttaacgccacagatccttgtgaacaatcttaaagacggaact
attccatcactctctgtcttcactttgatgatatttgatgaatgtcacaatacttgtaaa
caacacccatacaataagatcatgttctattatctggatcagaaacttggaggatcttct
gacccactgcctcaggtcgttgggatgactgcctctgttggtgttggggatgccaaaaac
acagatgaagccgtggaatatatctgcaaactctgtgcttctcttgatgcatcagtaata
gcaacggtcaaagagaatctggaagaactgcaagaaattgtttatacgccccagaaaatt
tccaggagagtagaatcacggactaccaatggatttaaacgcatcatatctcagctgatg
agagagacagaaagtctggcaaaggatgtctttgaagaactggaaaacttatctcaaatc
cagaacagggaatttggaacacagaagtacgaacagtggattgtcgaagtccataaagcg
tgcaggacgtttcagctgccagacaaagatgaagagagcaggatctgtaaagcgctatat
ttgtacacttcccatttgcggaagtacaacgatgccctcattatcagtgagcacgcacaa
atgaaagatgccctgaattacttaaacaatttcttcaaagatgtccgagcagcaggattt
gatgagactgaacaagatcttacccggagatttgaaggaaaggtgcaggaactagaaaca
gtttccatggatcccagcaatgagaatcctaaactcaaagacctgtacctcattttacaa
gaggagtaccacgtcaatccggagaccaaaaccattctgttcgtgaaaaccagagccctt
gtggacgctataaagaagtggattgaggaaaattctaaactcagctttctaaagcctggc
atattgactggacgtggcaaaactagtcagactacaggaatgacccttccagcacagaaa
tgtgtactggatgcattcagaagcaatggagaccacaatattttgattgccacctcagtt
gctgatgaaggcattgacattgctcagtgcaatctggtcatcctgtatgagtacgtgggc
aatgtcatcaaaatgatccagaccagaggcagaggaagagcaaaagggagcaagtgcctg
cttttgactagcaatgccgatgtaattgaaaaagaaaatataaacatgtacaaggagaaa
atgatgaatgaatccattttaagacttcagacatgcgatgaagcaaaatttaaaaaaaag
cttctctgtatacagactggtgaaaaaatcatcagagataatcaacaaaacttcaaacct
aaacttgataagcaaaataagaaactgctgtgtgcaaagtgcaaagccttggcatgttac
acatctgagataagaatggtaaaggattcccattacactgtggttggagagacttttaag
aagtgctttgtgaccagaccacaccccagaccaaagagttgtggggattttgacaagata
gggaagatattctgtgccagacaagactgcagccatgactggggaatccgtgcaaaggtc
aatgcttttgagattccattaatcaagattcagagttttgtggtggaagacactgtgact
ggaaaacagatgtgtccctcaaagtggaaggactttaattttgagaagataccatttaat
cctgaagaactgtctgaatga

DBGET integrated database retrieval system