KEGG   Oryctolagus cuniculus (rabbit): 100347722
Entry
100347722         CDS       T03373                                 

Gene name
ALK
Definition
(RefSeq) anaplastic lymphoma receptor tyrosine kinase
  KO
K05119  anaplastic lymphoma kinase [EC:2.7.10.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu05200  Pathways in cancer
ocu05223  Non-small cell lung cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100347722 (ALK)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100347722 (ALK)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    100347722 (ALK)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100347722 (ALK)
Protein kinases [BR:ocu01001]
 Receptor tyrosine kinases (RTK)
  ALK family
   100347722 (ALK)
CD molecules [BR:ocu04090]
 Proteins
  100347722 (ALK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr MAM Pkinase Gly_rich Ldl_recept_a FXa_inhibition
Other DBs
NCBI-GeneID: 100347722
NCBI-ProteinID: XP_017196335
Ensembl: ENSOCUG00000001085
LinkDB
Position
2
AA seq 1622 aa
MRAIGLLWLLPPLLSAAASSSGAAVGQRAGSPAVGPPLQPREPLSYSRLQRKSLAVDFVV
PSLFRVYARDLLLPPPSPPPSPPEPRAGQAEEHGSLALDCAPLLRLLGPPPGVSWAPASP
TLSRVLKGGSVRKLRRAKQLVLELSEEAILEGCLGPPEEAAAGLLQFNLSELFSWWIRHG
EGRLRVRLMPEKKASEGGREGRLSAAIRASQPRLLFQILGAGPSSLESPTNRPSPPPDYF
SWNLTWIMKDSFPFLSHRSRYGLECSFDFPCELEYSPPLHDLRNQSWSWRRVPSEEASQM
DFLDGPEAERSKERPRGSFLLLNTSADSKHTILSPWMRSSSEHCTLAVSVHRHLQPSGRY
VAQLLPHNKTGREILLVPTPGKHGWTVLQGRIGRPENPFRVALEYISSGNRSLSAVDFFA
LKNCSEGTSPGSKMALQSSFTCWNGTVLQLGRACDFHQDCAQGEDEGQLCSKLPAGFYCN
FEDGLCGWTQGVLSSRVPRWQVRTLKDAWSQDHQGHALLLSTTDAPSSESATMTSVTFPA
PMKNSPCELRMAWLIRGVLRGNVSLVLVENKTGREQSRILWHGAPGDGLSLWQWAVLPLL
DVSDRFWLQMVAWWEQGSRATVAFDNISISLDCYLTISGEDKTLQSTEPRSRNLFDGSPN
KESKPREATPRTPTFDPTVHWLFTTCGASGPHGPTQAQCNNAYQNSNQSVVVGSEGPLKG
IQIWTVPATDTYSISGYGAAGGKGGKNTMMRSHGVSVLGIFNLEKDDMLYILVGQQGEDA
CPSTNQLIQKVCIGENNVIEEEIRVNRSVHEWAGGGGGGGGATYVFKMKDGVPVPLIIAA
GGGGRAYGAKTDTFHPERLENNSSVLGLNGNSGAAGGGGGWNDNTSLLWAGKSLLEGATG
GHSCPQAMKKWGWETRGGFGGGGGGCSSGGGGGGYIGGNAASNNDPEMDGEDGISFISPL
GILYTPALKVMEGHGEVNIKHYLNCSHCEVDECHMDPETHKVICFCDHGTVLAQDGVSCV
VSPTAEPHLPLSLILSVVTSALVAALVLAFSGIMVVYRRKHQELQAMQMELQSPEYKLSK
LRTATIMTDYNPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGMPNDP
SPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQALPRFILLELMAGG
DLKSFPRGDPALRPNQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPG
TGRVAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWE
IFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILE
RIEYCTQDPDVINTALPIEYGPLVEEEEKVPMRPKDPEGVPPLLVAPAQAKREEAPVAAA
PAALPAASSGKAVKKPEAAAQAPARARRGPAVGGGHVNVAFAQSNPPSEMHKDQGSRNKP
TSLWNPTYGSWFTEKPARKNNAPAKKEPLDTRGHVGRAAGCTVPPGVAPGRLAGASLLLE
PSALTAGMKEVPLFRLRHFPCGNVNYGYQQQGLPLEATAAPGAGHYEDTILKTKGSGKQP
GP
NT seq 4869 nt   +upstreamnt  +downstreamnt
atgcgagccatcgggctcctgtggctgctaccgccgctgctctcggcggccgcttctagc
tccggggccgcggtcggccagcgcgcgggctctccggccgtgggtccacctctgcagccc
cgggagccgctcagctactcgcgcctacagaggaagagcctggcggtggacttcgtcgtg
ccctcgctcttccgcgtctacgcccgagacctgctgctgccgccgccgtcgcctccgccg
tcccccccggagccaagggctggccaggcggaggagcacggctcgctggcccttgactgc
gccccgctgctcaggctgctgggaccgccgcctggggtgtcctgggcgcccgcgtccccg
acgctgtccagggtgctgaagggcggctctgtgcgcaagctccggcgcgccaagcagctg
gtgctggagctgagcgaggaggcgatcctggagggctgcctgggacctcccgaggaggcg
gccgccgggctgctccagttcaacctcagcgagctgttcagctggtggattcgccacggc
gaggggcggctgagagtccgtctgatgcccgagaaaaaggcgtcggaagggggccgagag
ggaaggctgtctgcggccatccgcgcctcccagccacgccttctcttccagatcctcggc
gccggtcccagctcgttggaatcaccaacaaacaggccttctcctcctcctgactatttc
tcatggaatctgacctggataatgaaagattccttccctttcctgtcccatcgcagccga
tatggtctggagtgcagcttcgacttcccctgtgagctggagtattcgcctccactgcac
gacctgaggaaccagagctggtcgtggcgccgtgtcccctctgaggaggcctcccagatg
gactttctggatggacccgaggcagagcgctctaaggagaggcccagaggctctttcctc
ctcctcaacacctcagcagactccaaacacaccatcctgagcccgtggatgaggagcagc
agtgagcactgcacgctggccgtctcggtgcacaggcacctgcagccctctgggaggtat
gtggcccagctgctgccccacaacaagactggaagagagatcctcctggtgcccactcca
ggaaagcatgggtggacagtgctgcagggaagaattgggcgcccagagaacccattccga
gtggccctggaatacatctccagtgggaaccgaagcttgtctgcggtggacttctttgcc
ctgaagaactgcagtgaagggacatccccaggctccaagatggccctgcagagttccttc
acttgttggaacgggacagttctccagcttgggcgggcctgcgacttccaccaggactgc
gcccagggagaagacgagggccagctgtgcagtaaactccctgctggcttttactgcaac
ttcgaggatggcttgtgtggctggacccaaggcgtactctcatcccgtgtgcctcggtgg
caggtcaggaccctgaaggatgcctggtcccaggaccaccaaggccacgccctgctgctc
agcaccaccgacgccccctcatctgaaagcgctaccatgaccagtgttacgtttcccgca
ccaatgaagaactctccctgtgagctccgaatggcctggctcatccgtggagtcttgagg
ggaaacgtgtccttggtgctggtggagaataagactgggagggaacaaagcaggatcctc
tggcacggtgctcccggtgatggcctgagcctgtggcagtgggcagtgttgccgctcctc
gacgtgtccgacaggttctggctccagatggtcgcgtggtgggaacaaggatccagagcc
acggtggccttcgacaacatctccatcagcctggactgctacctcaccatcagtggagag
gacaaaactctacagagcacggaacccagatcaagaaatctgtttgatggtagcccaaac
aaggagtcgaaacccagggaggccacaccaaggacccccacctttgaccctacagttcac
tggctgttcacgacgtgcggggccagcgggccccatggccccacgcaggcccagtgcaac
aacgcctaccagaactccaaccagagcgtggtggtggggagcgaaggccccctgaagggc
atccagatctggacagtgccagccaccgacacctacagcatctcgggctatggagccgct
ggcgggaaaggcgggaagaacaccatgatgcggtcccatggcgtgtctgtgctaggcatc
ttcaacctggagaaggacgacatgctctacatcctggttgggcagcagggcgaggacgcc
tgccccagcacaaaccagttaattcagaaagtctgcattggcgagaataacgtgatagag
gaagagatccgtgtgaacagaagcgtgcacgagtgggcaggaggaggaggagggggcggt
ggagccacctacgtgtttaagatgaaggatggcgtgcccgtgcccctgatcattgcggcc
ggcggtggcggcagggcctatggggccaagacagacaccttccacccagagagactggaa
aataactcctcggtcctggggctgaacggcaactccggagccgcaggcggcggaggtggc
tggaatgataacacttccttgctctgggctggaaagtctttgctggagggagccaccgga
ggacattcctgcccccaggccatgaagaagtgggggtgggagacaagagggggtttcgga
gggggtggaggggggtgctcctccggtggaggaggcggaggatacataggcggcaacgca
gcctcaaacaatgaccctgagatggatggggaagatgggatttcatttatcagtccactg
ggcatcctgtacaccccagctttgaaagtgatggagggccatggggaagtgaatattaaa
cattacctaaactgcagtcactgtgaggtagacgaatgtcacatggacccggagacccac
aaggtcatctgcttctgtgaccacggaacggtgctggcccaggacggcgtctcctgtgtt
gtgtcacccactgcggagccccacctgccgctgtcgctgatcctctctgtggtcacctct
gccctagtggccgccctggtcctggctttctcaggcatcatggtcgtgtaccgccggaag
caccaggagctgcaggccatgcagatggaactgcagagccccgagtacaagctgagcaag
ctccgaaccgcgaccatcatgaccgactacaaccccaactactgcttcgccggcaagacc
tcctccatcagcgacctgaaggaggtgccccggaagaacatcaccctcattcggggcctg
ggccacggcgcgtttggggaggtgtacgaaggccaggtgtccggaatgcccaacgacccg
agccccctgcaggtggctgtgaagaccctgcctgaggtgtgttcagaacaggacgagctg
gatttcctcatggaggccctgatcatcagcaaattcaaccaccagaacatcgtgcgctgc
atcggcgtcagtcttcaggccctgccccggttcatcctgctggagctcatggcgggagga
gacctcaagtccttcccgcggggagaccccgccctccgcccgaatcagccctcctccctg
gccatgctggacctgctgcacgtggctcgggacattgcctgcggctgtcagtatctagag
gaaaaccatttcatccaccgggacattgctgccaggaactgcctcttgacctgtccaggc
acgggaagagtggccaagatcggagactttggaatggcccgagacatctacagagcgagc
tactacaggaagggaggctgtgcaatgctgccagttaagtggatgcccccggaggccttc
atggagggaatatttacctccaaaacagacacgtggtccttcggagtgctgctctgggaa
atattctctctcggatacatgccgtaccccagcaaaagcaaccaggaggtcctggagttc
gtcaccagcggaggccggatggacccgcccaagaactgcccggggcctgtataccggata
atgactcagtgctggcaacatcaaccagaagacaggcccaacttcgccataatattggag
aggattgaatattgcacccaggacccagacgtcatcaacactgccctgcccatagaatat
gggcccctggtggaagaggaggaaaaggtgcccatgcggcccaaggaccccgagggggtc
cctccgctgctggtggctccagcgcaggccaagcgggaggaggcgcccgtcgcagccgcg
cccgccgccctgcccgccgcttcgtctggcaaagccgtgaagaagcccgaagccgccgcc
caggcccccgcgcgcgcccgccgaggccccgccgtgggagggggacacgtgaacgtggcc
tttgcgcagtccaacccgccatcggagatgcacaaggaccaggggtccagaaacaagccg
accagcctgtggaacccgacgtacggctcgtggttcacggagaagcccgccagaaagaac
aatgccccggccaagaaggagcccctcgacaccagggggcacgtggggcgcgcggccggc
tgtactgtcccgcccggcgtggcgcccggccgcctggcgggggcctcgctgctgctcgag
ccgtcggcgctcaccgccggcatgaaggaggtgccgctgttccggctgcgccacttcccc
tgtgggaacgtcaactacggttaccagcagcagggcctgcccctggaggccacggcggcc
cctggcgccggccattacgaggacaccatcctgaaaaccaagggcagcggcaagcagccc
gggccctga

KEGG   Oryctolagus cuniculus (rabbit): 100352828
Entry
100352828         CDS       T03373                                 

Gene name
EML4
Definition
(RefSeq) echinoderm microtubule associated protein like 4
  KO
K15420  echinoderm microtubule-associated protein-like 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu05200  Pathways in cancer
ocu05223  Non-small cell lung cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100352828 (EML4)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100352828 (EML4)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    100352828 (EML4)
Cytoskeleton proteins [BR:ocu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EMAP
     100352828 (EML4)
SSDB
Motif
Pfam: HELP WD40 ANAPC4_WD40 Ribosomal_S7
Other DBs
NCBI-GeneID: 100352828
NCBI-ProteinID: XP_008252697
Ensembl: ENSOCUG00000015526
LinkDB
Position
2
AA seq 993 aa
MDGFAGSLDDSISAASTSDVQDRLSALELRVQQQEDEITLLKAALADVLRRLAISEDHVA
SVKKSVPSKGQPGLREAISMSCITNGSGANRKPGHSSSVSIARKETLSSAAKSGTEKKKE
KPQGQREKKEESHSNDQSPQIRASPSPQPSSQPLQIHRQTPESKNSTPTKSIKRPPTAEK
SHNSWENSDDNRNKLLRTPSTSKLISKVTKNTDKHKDVIINQAKMSTREKNSQEGEYIKM
FMRGRPITMFIPSDIDNYDDIRTELPPEKLKLEWAYGYRGKDCRANVYLLPTGEIVYFIA
SVVVLFNYEERTQRHYLGHTDCVKCLAIHPDKIRIATGQIAGVDKDGRPLQPHVRVWDSV
SLSTLQIIGLGTFERGVGCLDFSKADSGVHLCVIDDSNEHMLTVWDWQKKSKGAEIKTTN
EVVLAVEFHPTDANTIITCGKSHIFFWTWSGNSLTRKQGIFGKYEKPKFVQCLAFLGNGD
VLTGDSGGVLLIWSKTTVEPTPGKGPKGVYQISKQIKAHDGSVFTLCQMRNGMILTGGGK
DRKIILWDHDLNPEREIEVPDQYGTIRAVAEGKADQFLVGTSRNFILRGTFNDGFQIEVQ
GHTDELWGLATHPFKDLLLTCAQDRQVCMWNSVEHKLEWTRLVDEPGHCADFHPSGTVVA
IGTHSGRWFVLDAETRDLVSIHTDGNEQLSVMRYSVDGTFLAVGSHDNFIYLYVVSENGR
KYSRYGKCTGHSSYITHLDWSPDNKNIMSNSGDYEILYWDIPGGCKLIRNRSDCKDIDWT
TYTCVLGFQVFGVWPEGSDGTDINALVRSHNRKVIAVADDFCKVHLFQYPCSKAKAPSHK
YSAHSSHVTNVSFTHNDSHLISTGGKDMSIIQWKLVEKLPLPQNETAVDTALTKVPPSST
ESTIQPHSPLLPAPQPLPMTAEEESRISSNSPTPLENSLEQTVQPSEEPSEEQSEGGSEE
LGEPLDEEPATEVSEEQGEAPLPEDQQDSPALS
NT seq 2982 nt   +upstreamnt  +downstreamnt
atggacggtttcgccggcagcctcgatgatagtatttctgctgcaagtacgtctgatgtt
caggatcgcctctcagccctggagttacgagtccaacaacaggaagatgaaatcactctg
ttaaaggcagctttggctgatgttctgagacgtcttgcaatctctgaagatcatgtggcc
tcagtgaaaaaatcagtcccaagtaaaggccagccaggccttcgggaagcgatttccatg
tcctgtataaccaatggaagtggtgcaaacagaaaaccaggtcactcaagctctgtctca
attgcaagaaaagaaacactttcatctgctgctaaaagtggtacagaaaaaaagaaagaa
aaaccacaaggacagagagaaaaaaaagaggaatctcattctaatgatcaaagtccacaa
attcgagcatcaccttctccccagccctcttcacagcctctccaaatacacagacaaact
ccagaaagcaagaattctactcccaccaaaagtataaaacgaccaccaacagctgaaaag
tcacataactcatgggaaaattcagatgataatcgtaataaattactgagaactccttca
acatcaaaattaatatcaaaagttactaaaaatacagacaagcataaagatgtcatcatc
aaccaagcaaaaatgtcaacccgtgaaaaaaacagccaagaaggagaatatattaaaatg
tttatgcggggtcggccaattacaatgttcattccttctgatattgacaactatgatgac
atcagaacagaactgcctcctgagaagctcaaactggagtgggcatatggttatcgagga
aaggactgtcgagctaatgtttaccttcttcctactggggaaatagtttatttcattgca
tcagtagtagtactatttaattatgaagagagaactcaacgccattacctgggtcataca
gactgtgtgaaatgccttgccatacaccctgacaaaattaggattgcaactggacagatt
gctggagtggataaagatggaaggccccttcaaccccacgtcagagtgtgggattcagtt
agtctgtccacactgcagattattggacttggaacttttgagcgtggagtaggatgtctg
gatttttcaaaagctgattcaggtgttcatttatgcgttattgatgactccaatgagcat
atgcttactgtttgggactggcagaaaaaatcaaaaggagcagaaataaagacaacaaat
gaagttgttttggctgtggagtttcacccaacagatgcaaataccataataacatgtggt
aaatctcatatttttttctggacctggagtggcaattcactaacaagaaaacagggaatt
tttgggaaatatgaaaaaccaaaatttgtgcagtgtttagcattcttgggcaatggagat
gttcttactggagactcgggtggagtcctgcttatatggagcaaaactactgtagagcca
acacctgggaaaggaccgaaaggtgtatatcagatcagcaagcaaatcaaagctcatgat
ggcagtgtgttcacactttgtcagatgagaaatgggatgatattaaccggaggagggaaa
gacagaaaaataattctatgggatcatgatctgaatcctgaaagagaaatagaggtccct
gatcagtatggcacaatcagagccgtagcagaagggaaggcagatcagtttttagtaggt
acatcacgaaactttattttgcggggaacatttaacgatggcttccaaatagaagtgcag
ggtcatacagatgagctctggggtcttgccacacatcccttcaaagacttgctcttgaca
tgtgctcaggacaggcaggtgtgcatgtggaattcagtggaacacaagctggaatggacc
aggctcgtagatgaaccaggacactgtgcagattttcatccaagtggcacagtggtggcc
ataggaacgcactcaggcaggtggtttgttctggatgcagaaaccagagatctagtttct
atccacacagatggaaatgagcagctctctgtgatgcgatactcagtagatggcaccttc
ctggctgtaggatctcatgacaactttatttacctctatgtagtctcagaaaatggaaga
aaatatagcagatatggaaagtgcactggacattccagctacatcacacaccttgactgg
tccccagacaacaagaatataatgtctaactctggagattatgagatattatactgggac
attccaggcggctgcaaactaatcaggaaccgatcagattgtaaggacattgattggacg
acgtacacctgtgtgctaggctttcaagtctttggtgtctggccagaaggatctgatgga
acagacatcaatgccctggtgcgatcccacaacagaaaggtgatcgctgtcgctgatgac
ttttgcaaagtccatctgtttcagtatccatgctccaaagcaaaggctcctagtcacaag
tacagtgcccacagcagccatgtcaccaacgtcagttttactcataatgacagtcatctg
atttcaactggtggaaaagacatgagcatcattcagtggaaacttgtggaaaagttacct
ttgcctcagaacgagactgcagtggataccgctctaaccaaagtccccccctcttctacg
gaaagtaccatccagcctcattctcctctgctgcccgccccccagcccttacccatgacg
gctgaagaggaaagtagaataagcagtaattctcccacacctctggagaatagcctggaa
cagacggtgcagcccagtgaagagcccagtgaggagcagagtgaagggggcagtgaagag
ctcggtgagcccttggatgaagagccagccactgaggtgagtgaggagcagggggaagct
cctctccccgaggaccagcaggactctccagccctgtcctaa

DBGET integrated database retrieval system