KEGG   Oryctolagus cuniculus (rabbit): 100348044
Entry
100348044         CDS       T03373                                 

Gene name
SYMPK
Definition
(RefSeq) symplekin
  KO
K06100  symplekin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
ocu04530  Tight junction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100348044 (SYMPK)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100348044 (SYMPK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ocu03021]
    100348044 (SYMPK)
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100348044 (SYMPK)
Transcription machinery [BR:ocu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100348044 (SYMPK)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage stimulation factor (CSTF) complex
     100348044 (SYMPK)
SSDB
Motif
Pfam: Symplekin_C DUF3453 DUF4667 Cnd1 DUF3385 SR-25
Other DBs
NCBI-GeneID: 100348044
NCBI-ProteinID: XP_008251057
Ensembl: ENSOCUG00000005511
LinkDB
Position
Un
AA seq 1301 aa
MASGSGDSVTRRSVASQFFTQEEGPGIDGMTTSERVVDLLNQAALITSDSKITVLRQVQE
LIINKDPTLLDNFLDEIIAFQADKSIEVRKFVIGFIEEACKRDIELLLKLIANLNMLLRD
ENVNVVKKAILTMTQLYKVALQWMVKSRVISELQEACWDMVSAMAGDIILLLDSDNDGIR
THAIKFVEGLIVTLSPRMADSEIPRRQEHDISLDRIPRDHPYIQHSVLWEEGKAALEQLL
KFMVHPAISSINLTTALGSLANIARQRPMFMSEVIQAYETLHANLPPTLAKSQVSSVRKN
LKLHLLSVLKHPASLEFQAQITTLLVDLGAPQAEIARNMPSSKDARKRPRDDSDSALKKM
KLEPNLGEDDEDKDLEPGPSGTSKASAQLSGQSDTDITAEFLQPLLTPDNVANLVLISMV
YLPEAMPASFQAIYTPVESAGTEAQIKHLARLMATQMTAAGLGPGVEQTKQCKEEPKEEK
VVKPESVLIKRRLSAQGQAISVVGSLSAMSPLEEEVPQAKRRPEPIIPVTQPRLAGAGGR
KKIFRLSDVLKPLTDAQVEAMKLSAVKRILRAEKAVACSGAAQVRVKILASLVTQFDSGL
KAEVLAFILEDVRARLDLAFAWLYQEYNAYLAAGASGTLDKYEDCLIRLLSGLQEKPDQK
DGIFTKVVLEAPLITESALEVIRKYCEDESRTYLGMSTLRDLIFKRPSRQFQYLHVLLDL
SSHEKDKVRSQALLFIKRMYEKEQLREYVEKFALNYLQLLVHPNPPSVLFGADKDTEVAA
PWTEETVKQCLHLYLALLPHNHKLIHELAAVYTEAIADIKRTVLRVIEQPIRGMGMNSPE
LLLLVEHCPKGAETLVTRCLHSLTDKVPPSPELVKRVRDLYHKRLPDVRFLIPVLNGLEK
KEVIQALPKLIKLNPIVVKEVFNRLLGTQHGEGNSALSPLNPGELLIALHNIDSVKCDMK
SIIKATNLCFAERNVYTSEVLAVVMQQLMEQSPLPMLLMRTVIQSLTMYPRLGGFVMNIL
SRLIMKQVWKYPKVWEGFIKCCQRTKPQSFQVILQLPPQQLGAVFDKCPELREPLLAHVR
SFTPHQQAHIPNSIMAILEASGKQEPEAKEAPAGPMEEDDLEPLALAPAPAPAPAPAPAP
AAAPRPPQDLIGLRLAQEKALKRQLEEEQKLKPAPPAPSSTSSSSSSSSSSSSSSSSSTS
SSSSSNSARPGPPPAEEAIDFRDEGPECETPGIFISVDVDSGLSEAALLDSSLEGPLPKE
AAASGKEERSPQALAPAADEAVKTPSPAAEEAGEPEAKGHS
NT seq 3906 nt   +upstreamnt  +downstreamnt
atggcgagtggcagcggggacagtgtcacccgccggagcgtggcgtcacagttcttcacg
caagaggagggcccaggcattgatggcatgaccacctccgagagggtggtggatctcctg
aaccaggcggcgctgatcaccagtgactcgaagatcacagtgctcaggcaggtccaggag
ctgatcatcaacaaagaccccacgctgctggacaacttcctggatgagatcatcgctttc
caagcagacaagtccatcgaagtgcgcaagtttgtcatcggcttcattgaggaggcatgc
aagcgggacatcgaattactgctgaagctgatcgcgaacctcaacatgctgctgagggac
gagaacgtgaatgtggtgaagaaggccatcctcaccatgacccagctctacaaggtggcc
ctgcagtggatggtgaagtcacgggtcatcagtgagctccaggaggcctgctgggacatg
gtgtctgccatggccggggacatcatcctgctcttggactctgacaacgatggcatccgc
acccacgccatcaagtttgtggagggtctcattgtcaccctgtcgccccgcatggccgac
tcggagatacccagacgtcaggaacatgacatcagcctggaccgcatccctcgtgaccac
ccctacatccagcacagtgtgctgtgggaagaggggaaggcggccttggagcagcttctc
aagttcatggtgcaccccgccatctcctccatcaacctgaccacagcgctgggctccctc
gccaacatcgcccgccagagacccatgttcatgtccgaggtgatccaagcctacgagacc
ctgcacgccaacctcccgccgacgctggccaagtctcaggtgagcagcgtgcgcaagaac
ctcaagctgcacctgctgagcgtgctcaagcacccggcctccctggagttccaggcccag
atcaccaccctgctggtggacctgggcgcgccgcaggccgagatcgcccgcaacatgccc
agcagcaaggacgcccgcaagcggccgcgcgacgactcggattctgcgctgaagaagatg
aagctggagcccaacctgggggaagacgacgaggacaaggacttagagccaggcccatcg
gggacctccaaggcctcggcccagctctcaggccagtcagacacagacatcacagccgag
ttcctgcagcctctgctgacgcccgacaatgtggccaatctggtcctcatcagcatggtg
tacctgcctgaggccatgcccgcctccttccaagccatctacacccccgtggagtcagcc
ggcaccgaagcccagatcaagcacctggctcggctcatggccacacagatgacggccgca
ggactggggcctggcgtggagcagaccaagcagtgcaaggaggagcccaaggaggagaag
gtggtgaagccagagagcgtcctgatcaagcggcgcctgtctgctcagggccaagccatc
tcggtggtggggtccctgagcgccatgtcccccctggaggaggaggtgccccaggccaag
aggaggccggagcccatcatccctgtgacgcagcctcggctggcgggcgccggcgggcgt
aagaaaatcttccgtctaagcgacgtgctgaagcccctgaccgacgcccaggttgaggcc
atgaagctgagtgctgtgaagcggatcctgcgggccgagaaggccgtggcctgcagtggg
gcggcccaggtgcgcgtgaagatcctggccagcctggtgacacagtttgactcggggctg
aaggccgaggtgctggccttcatcctggaggatgtgcgggcccgcctggacctggccttc
gcctggctctaccaggagtacaacgcctacctggcagctggcgcctcgggcaccctggac
aagtacgaggactgcctcatccgcctgctctccggccttcaggagaaaccggaccagaag
gacgggatcttcaccaaggttgtgctggaggcgccgctgatcaccgagagtgccctggag
gtgatccgcaagtactgcgaggacgagagtcgcacctacctgggcatgtccaccctccga
gacctgatcttcaagcgcccgtcccgtcagttccagtacctgcatgtcctcctggacctg
agctcccacgagaaggacaaggtgcgctcgcaggccctgctgttcatcaagcgcatgtac
gagaaggagcagctgcgggagtacgtggagaagttcgccctcaactacctgcagctgctg
gtgcaccccaacccaccctcggtgctcttcggggccgacaaggacacagaggtggcggcg
ccctggaccgaggagacggtgaagcagtgcctgcacctctacctggccctcttgcctcac
aaccacaagctgatccacgagctggccgccgtgtacaccgaggccatcgccgacatcaag
cgcacggtgctgagggtcatcgagcagccgattcgagggatgggcatgaactccccagag
ctgctgctgctggtggaacactgccccaagggggccgagacgctggtcacccgatgtctg
cacagcctcacagacaaagtcccgccctccccggagctggtgaagcgggtccgcgacctg
taccacaagcggctgccggacgtgcgcttcctcatccccgtgctgaacgggctggagaag
aaggaggtgatccaggccctgcctaagctcatcaagctcaaccccatcgtggtgaaggag
gtcttcaaccgcctgctgggcacccagcacggtgaggggaactcggccctgtcccccctg
aaccccggagagctcctcatcgcgctgcacaacatcgactcggtgaaatgtgacatgaag
tccatcatcaaagccaccaacctgtgcttcgcggagcggaacgtgtacacgtcggaggtg
ctggccgtggtgatgcagcagctgatggaacagagccccctgcccatgctgctcatgcgg
accgtcatccagtccctgaccatgtacccccgcctggggggcttcgtcatgaacatcctg
tcccgcctcatcatgaagcaggtctggaagtaccccaaggtgtgggagggcttcatcaag
tgctgccagcgcaccaagccccagagcttccaggtcatcctgcagctgccgccccagcag
ctgggggccgtctttgacaagtgcccggagctccgcgagcccctgctggcccacgtccgc
tccttcaccccccaccagcaagcacacatccccaactctatcatggccatcctggaggcc
agcggcaagcaggagccagaggctaaggaggcacctgcggggcccatggaagaggacgac
ctggagcccctggccctggccccggctccagctccggccccagccccggccccggccccg
gccgcagccccgcggccccctcaggacctcatcggcctgcggctggctcaggagaaggcc
ttgaagcggcagctggaggaggagcagaagctgaagcctgcaccccccgccccatcctcc
acctcctcgtcctcctcctcctcctcgtcctcctcctcctcctcgtcctcctccacatcc
tcctcctcctcctccaactctgcgcggccgggccctcccccggcggaagaagccatagat
ttccgggacgaggggcccgagtgcgagacccccggcattttcatcagcgtggatgtggac
tcggggctgagtgaggccgcgctgctggactccagcctcgaggggcccctgcccaaggag
gcggcggccagcgggaaggaggagcggagcccccaggccctcgcccctgcagccgacgag
gccgtgaagacccccagccctgccgccgaggaagcgggggagcccgaggccaaggggcac
agctga

DBGET integrated database retrieval system