KEGG   Oryctolagus cuniculus (rabbit): 100348266
Entry
100348266         CDS       T03373                                 

Gene name
CCL5
Definition
(RefSeq) C-C motif chemokine ligand 5
  KO
K12499  C-C motif chemokine 5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04668  TNF signaling pathway
ocu05020  Prion disease
ocu05142  Chagas disease
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05168  Herpes simplex virus 1 infection
ocu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100348266 (CCL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100348266 (CCL5)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100348266 (CCL5)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100348266 (CCL5)
   04621 NOD-like receptor signaling pathway
    100348266 (CCL5)
   04623 Cytosolic DNA-sensing pathway
    100348266 (CCL5)
   04062 Chemokine signaling pathway
    100348266 (CCL5)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100348266 (CCL5)
  09164 Neurodegenerative disease
   05020 Prion disease
    100348266 (CCL5)
  09172 Infectious disease: viral
   05164 Influenza A
    100348266 (CCL5)
   05168 Herpes simplex virus 1 infection
    100348266 (CCL5)
   05163 Human cytomegalovirus infection
    100348266 (CCL5)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100348266 (CCL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100348266 (CCL5)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100348266 (CCL5)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100348266 (CCL5)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Haparin
  Chemokines
   100348266 (CCL5)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100348266
NCBI-ProteinID: XP_017204526
Ensembl: ENSOCUG00000002848
UniProt: G1SIG1
LinkDB
Position
19
AA seq 91 aa
MEVSAAALAVLLTAAALCAPASASPYASDTTPCCFAYISRLLPRAHVTEYFYTSGKCSFP
AVVFVTRKNRQVCANPEKKWVREYINSLEMS
NT seq 276 nt   +upstreamnt  +downstreamnt
atggaggtctccgccgccgccctcgccgtcctcctcaccgctgctgccctctgcgcacct
gcatctgcctccccatatgcctcggacaccacgccctgctgctttgcctacatctcccgc
ctgctgccccgggcccacgtcacggagtatttctataccagcggcaagtgctccttcccg
gcagttgtctttgtcaccaggaagaaccgccaggtgtgtgccaacccagagaagaaatgg
gttcgggagtacatcaactctttggagatgagctaa

DBGET integrated database retrieval system