KEGG   Oryctolagus cuniculus (rabbit): 100348459
Entry
100348459         CDS       T03373                                 

Gene name
TYMP
Definition
(RefSeq) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00240  Pyrimidine metabolism
ocu00983  Drug metabolism - other enzymes
ocu01100  Metabolic pathways
ocu05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    100348459 (TYMP)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100348459 (TYMP)
 09160 Human Diseases
  09162 Cancer: specific types
   05219 Bladder cancer
    100348459 (TYMP)
Enzymes [BR:ocu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     100348459 (TYMP)
SSDB
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N PYNP_C
Other DBs
NCBI-GeneID: 100348459
NCBI-ProteinID: XP_002723933
Ensembl: ENSOCUG00000001408
LinkDB
Position
Un
AA seq 479 aa
MTTPETPGAPGDPAAGGGGGPAEAPPEPRQLPELIRTKRDGGRLTEADIGGFVRAVVDRS
AQDAQIGAMLMAIRLQGMDLEETSALTQALAKSGQQLEWPEAWHQQLVDKHSTGGVGDKV
SLVLAPALAACGCKVPMISGRGLGHTGGTLDKLESIPGFSVLQSPEQMQALLEGVGCCIV
GQSEQLVPADGILYAARDVTATVDSLPLITASILSKKAVEGLSALVVDVKFGEAAVFPSQ
EQARELARALVGVGAGLGLRVAAALTAMDNPLGRNVGHTLEVEEALLCLDGLGPPDLRDL
VTRLGGALLWLSGQAEAQAEGAARVAAALDDGSARDRFERMLAGQGVDAGLAQALCSGTP
AQRRQLLPCAQHQEELCSPADGTVERIRALALARVLHELGAGRSRAGQPLRHGVGAELLV
TVGQRLRRGTPWLRVHLDQPALGGPQRRALQGALVLSGREPFVAPSPFAELVLPPPAAH
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgacgacccctgagaccccaggagcgcccggggaccccgctgcgggagggggcgggggc
cctgctgaagccccgccggagcccaggcagctcccggagctgatccgcaccaagcgagac
ggaggccgcctgaccgaggcggacatcgggggcttcgtgcgcgccgtggtggaccgcagc
gcacaggatgcgcagatcggggccatgctgatggccatccggctgcagggcatggatctg
gaagagacctcggcactgacccaggccctggccaagtctgggcagcaactggagtggcca
gaggcctggcaccagcagctggtggacaagcactccacagggggcgtgggtgacaaggtc
agcctggtcctggcaccagcgctggctgcctgcggctgcaaggtgccaatgatcagtgga
cgtggtctgggacacacagggggcaccctggataagctagagtctattcctggattcagt
gtcctccagagcccggagcagatgcaagcgttgctggagggagtgggctgctgcatcgtg
ggccagagcgagcagctggtccccgcggatgggatcctgtacgcagcgagggacgtgacg
gccaccgtggacagcctgccgctcatcacagcctccatcctcagtaagaaagctgtggag
ggactgtccgctctggtggtggacgtcaagtttggagaggctgccgtcttccccagccag
gagcaagcccgggagctggcgagggcgctggtgggcgtgggggcaggcctggggctccgg
gtagccgcagccctgaccgccatggacaaccccctgggccgcaacgtgggccacaccctg
gaggtggaggaggcgctgctctgcctggacggtctggggccgccagacctgcgagacctg
gtcacgaggctcgggggcgcactgctctggctcagcgggcaggccgaggcgcaggccgag
ggcgccgcgcgggtggccgcggcgctggacgacggctcggcccgtgaccgcttcgagcgg
atgctcgcgggccagggcgtggacgcgggtctggcccaagccctgtgttctgggaccccg
gctcagcgccggcagctgctgccctgcgcccagcaccaggaggagctgtgctcgcccgcg
gacggcaccgtggagcgcatccgggcgctggcgctggcgcgcgtgctgcacgagctgggg
gccggacgcagccgcgcggggcagcctctccggcacggcgtgggtgccgaactgctggtc
accgtgggacagaggctgcgccgcgggacgccctggctccgcgtgcacctggaccagccc
gcgctcggcggcccgcagcgccgcgccctgcagggggcgctcgtgctctccggccgcgag
cccttcgtcgccccctcccccttcgccgagctcgtcctcccgccgcccgcggcgcactag

DBGET integrated database retrieval system