KEGG   Oryctolagus cuniculus (rabbit): 100348489
Entry
100348489         CDS       T03373                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin dependent kinase inhibitor 1A
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01522  Endocrine resistance
ocu01524  Platinum drug resistance
ocu04012  ErbB signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04068  FoxO signaling pathway
ocu04110  Cell cycle
ocu04115  p53 signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04218  Cellular senescence
ocu04630  JAK-STAT signaling pathway
ocu04921  Oxytocin signaling pathway
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04934  Cushing syndrome
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05163  Human cytomegalovirus infection
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05169  Epstein-Barr virus infection
ocu05200  Pathways in cancer
ocu05202  Transcriptional misregulation in cancer
ocu05203  Viral carcinogenesis
ocu05205  Proteoglycans in cancer
ocu05206  MicroRNAs in cancer
ocu05210  Colorectal cancer
ocu05211  Renal cell carcinoma
ocu05212  Pancreatic cancer
ocu05213  Endometrial cancer
ocu05214  Glioma
ocu05215  Prostate cancer
ocu05216  Thyroid cancer
ocu05217  Basal cell carcinoma
ocu05218  Melanoma
ocu05219  Bladder cancer
ocu05220  Chronic myeloid leukemia
ocu05222  Small cell lung cancer
ocu05223  Non-small cell lung cancer
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100348489 (CDKN1A)
   04630 JAK-STAT signaling pathway
    100348489 (CDKN1A)
   04066 HIF-1 signaling pathway
    100348489 (CDKN1A)
   04068 FoxO signaling pathway
    100348489 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    100348489 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100348489 (CDKN1A)
   04115 p53 signaling pathway
    100348489 (CDKN1A)
   04218 Cellular senescence
    100348489 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100348489 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    100348489 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100348489 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    100348489 (CDKN1A)
   05206 MicroRNAs in cancer
    100348489 (CDKN1A)
   05205 Proteoglycans in cancer
    100348489 (CDKN1A)
   05203 Viral carcinogenesis
    100348489 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100348489 (CDKN1A)
   05212 Pancreatic cancer
    100348489 (CDKN1A)
   05225 Hepatocellular carcinoma
    100348489 (CDKN1A)
   05226 Gastric cancer
    100348489 (CDKN1A)
   05214 Glioma
    100348489 (CDKN1A)
   05216 Thyroid cancer
    100348489 (CDKN1A)
   05220 Chronic myeloid leukemia
    100348489 (CDKN1A)
   05217 Basal cell carcinoma
    100348489 (CDKN1A)
   05218 Melanoma
    100348489 (CDKN1A)
   05211 Renal cell carcinoma
    100348489 (CDKN1A)
   05219 Bladder cancer
    100348489 (CDKN1A)
   05215 Prostate cancer
    100348489 (CDKN1A)
   05213 Endometrial cancer
    100348489 (CDKN1A)
   05224 Breast cancer
    100348489 (CDKN1A)
   05222 Small cell lung cancer
    100348489 (CDKN1A)
   05223 Non-small cell lung cancer
    100348489 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100348489 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100348489 (CDKN1A)
   05161 Hepatitis B
    100348489 (CDKN1A)
   05160 Hepatitis C
    100348489 (CDKN1A)
   05163 Human cytomegalovirus infection
    100348489 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100348489 (CDKN1A)
   05169 Epstein-Barr virus infection
    100348489 (CDKN1A)
   05165 Human papillomavirus infection
    100348489 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100348489 (CDKN1A)
   01522 Endocrine resistance
    100348489 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 100348489
NCBI-ProteinID: XP_002714715
Ensembl: ENSOCUG00000016048
LinkDB
Position
12
AA seq 164 aa
MSQPSDEAPQPPHRSKACRRLFGPVDSEQLRRDCDALMADCLQEARERWNFDFVTETPLE
GNFAWERVRGLGLPKLYLAPGPRGGREDPAGCKRPSTSATLLPAAQEDHVDLSLTCTLVP
RSPERPEESPGGPGTSQGRKRRRQTSLTDFYHSKRRLVFSKRKP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtcgcagccgtcggacgaggcgccacagcccccgcacaggagcaaggcttgccgccgc
ctcttcgggcccgtggacagcgagcagctgcgccgagactgcgacgcactcatggccgac
tgcctgcaggaggcccgcgagcgctggaacttcgactttgtcaccgagacgccgctggag
ggcaacttcgcctgggagcgcgtgcggggcctgggtctgcccaagctctacctggccccg
gggccccggggtggcagggaggacccggcagggtgcaagcggccgagcacctcagccacc
ctgctgccggcggctcaggaggaccacgtggacctgtcgctgacctgcaccctggtacct
cgctccccggaacggcctgaggagtccccaggcgggcctggtacctctcagggtcggaaa
cggcggcggcagaccagcctgacagatttctaccactccaaacgccgactcgtcttctcc
aagaggaagccgtaa

DBGET integrated database retrieval system